KEGG   Vibrio nigripulchritudo: VIBNI_A1113Help
Entry
VIBNI_A1113       CDS       T02871                                 

Definition
(GenBank) putative decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni00650  Butanoate metabolism
vni01100  Metabolic pathways
vni01110  Biosynthesis of secondary metabolites
vni01120  Microbial metabolism in diverse environments
vni02024  Quorum sensing
Module
vni_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VIBNI_A1113
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VIBNI_A1113
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VIBNI_A1113
   00430 Taurine and hypotaurine metabolism
    VIBNI_A1113
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VIBNI_A1113
Enzymes [BR:vni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VIBNI_A1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS VWA
Motif
Other DBs
NCBI-ProteinID: CCO57261
UniProt: U4K3X4
LinkDB All DBs
Position
1:complement(1196422..1198077)
Genome map
AA seq 551 aa AA seqDB search
MVSENKTADVSFESLLKIFTVPEAPDSTLGHIENKLSQNLNQFLREHIVAEEKPLADIEQ
QFSNPYLPEQPQFVSEHTQNLLDNLVSQSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHGLIYHEKPEFYQQWMHSANHSLGAFCSGGTIANITA
LWVARNNTLKADGEFKGVEKEGLFKAMKHYGYEGLAILVSERGHYSLKKAADVLGLGQEC
LVSVKTDSKNKLCPDDLEQKIALLKSQNIKPFAIVGVAGTTETGNIDPLERIAVISQKHG
CHFHVDAAWGGATLMSNNYRHLLKGIELADSVTIDAHKQLYIPMGAGMVLFKDPSAMTAI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYSSMHIISRPGYELLIDQSIEKAKYFASL
VSEQDDFELVTEPELCLLTYRYVPEVAKKALVNANEDEKGALHEALNNLTKQIQKKQRET
GKTFVSRTRLNPVQWQHRNTIVFRVVLANPLTTHEILQSVLCEQREIAAGFPNLMTQVSE
LSMEILNKKAS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggtatctgagaataaaacagcagatgtaagctttgaaagtttgctgaaaatctttact
gtgccagaagcgccagattccacattaggtcatatcgaaaacaaactctcgcaaaacctg
aaccagtttttgcgtgaacatattgttgcggaagaaaaaccgctggcggatattgaacag
cagttttcgaacccttatttgcccgagcaacctcagtttgtatctgaacatacgcagaac
ttgctcgataacctcgtttcgcagtccgttcatacctcggcacccagtttcatcggtcat
atgacttcagccctgccctactttttgatgccactatcaaaaattatgatcgcgctgaac
caaaacttggtgaagatcgaaacctcaaaagctttcaccccattggaaagacaagttctt
ggtatgcttcatggtcttatctaccatgaaaagccagagttttatcagcaatggatgcac
agcgccaatcattcactaggcgcattctgctctggcggcactattgcgaatatcactgct
ctctgggttgcaaggaacaacacgctaaaagcagatggcgaattcaaaggggtagaaaaa
gaaggcttattcaaagccatgaagcattatggctacgagggtttagctattttagtttca
gagcgcggacactactctttgaaaaaagcagcagatgttttgggattaggtcaggaatgc
ctcgtttcagtcaaaacagacagtaaaaacaaactgtgccctgacgaccttgaacaaaaa
atcgccttacttaaaagccagaacatcaaaccatttgctatcgtcggtgtcgcaggtact
accgaaacaggaaacattgatccgctagaacgaatcgcggtgatcagccagaaacacggc
tgccatttccatgtggatgctgcctggggtggcgcaaccctgatgtcgaacaactatcgc
catttacttaaagggattgagctagcagattcggtcaccattgatgcccataagcagcta
tacataccgatgggtgctggcatggttctgtttaaagatccaagcgctatgaccgccatt
gagcatcacgcacagtacatcctccgtaaagggtcgaaagacctaggcagtcatacactg
gaaggctcccgttcgggaatggcgatgctggtttattcgagcatgcacatcataagtcgc
ccaggttatgaactcttaattgatcagagtatagaaaaggcaaaatacttcgcctcgttg
gtttctgaacaagatgattttgagctggtgacggaaccagagctttgtcttcttacgtat
cgctatgttccagaagtagcgaaaaaagcgttagttaatgcgaatgaagacgagaaaggt
gcccttcacgaagctttgaacaatttgacaaagcaaattcaaaagaagcaaagggaaaca
ggtaaaacctttgtatcaagaacccgattgaacccagtacagtggcagcacagaaatacc
attgttttccgcgtagttctggctaacccacttactacacatgaaatattgcaatcggta
ttatgtgagcaaagggaaattgctgccggttttcctaatctaatgactcaagtatctgag
ctttctatggaaattttgaataagaaggcaagctaa

DBGET integrated database retrieval system