KEGG   Vibrio nigripulchritudo: VIBNI_A1785
Entry
VIBNI_A1785       CDS       T02871                                 

Gene name
rlmL
Definition
(GenBank) Ribosomal RNA large subunit methyltransferase L
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
vni  Vibrio nigripulchritudo
Brite
KEGG Orthology (KO) [BR:vni00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vni03009]
    VIBNI_A1785 (rlmL)
Enzymes [BR:vni01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     VIBNI_A1785 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     VIBNI_A1785 (rlmL)
Ribosome biogenesis [BR:vni03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    VIBNI_A1785 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 Methyltransf_31 THUMP Methyltransf_25 Methyltransf_11 Methyltransf_15 Methyltransf_24 N6_Mtase Methyltransf_3
Other DBs
NCBI-ProteinID: CCO57886
UniProt: U4K5L7
LinkDB
Position
1:complement(1863091..1865217)
AA seq 708 aa
MNQYLAVTSNGLENLLVDELKTLGISDPKPVQAGVKFKATNAQIYRVCLWSRLASRFVRI
LAEFNCQDDMDLYLSVTAVNWASHFDSNKTFVVDFNGTNREIRNSQYGALKVKDGIVDSF
NKKNLPRPSIRKDQPDLRVHVRLFKDKALVGFDMVGSGLHHRGYRTESGRAPLRETLAAA
IISRCGWEQGMPLLDPMCGSGTLLIEAAMIAANMAPGVHRKYWCFESLKDFEPETWAEIK
SEANVQARRGTKKVESKFYGFDNDTRVLKTARENAKRAGVESLIHFEKGDAAQIKRPGSF
DNGMIVSNPPYGERLGTHPGLIALYTAFGGQLKTEFGGCKASIFSSSDELLSCLRMRADK
QFKLNNGALQCHQKNYSISERAPGDTAKAADSETLIAPDFANRLKKNLGKLGKWARKEKL
DCYRVYDADLPEYNAAIDIYQDHVVIQEYAAPKNIPEEKTKRRLTDMIRATIQVTGVEAN
NVVLKVREKKKGSSQYQKLSQDSEFMQVTEYGVELLVNLHDYLDTGLFLDHKLTRRKLGQ
MAGGKDFLNLFAYTGSATVHAACGGAKSTTTVDMSKTYLEWAQENLNINGLGGNEHEFIQ
ADCLQWLEQADEDFDLIFIDPPTFSNSKRMEQSFDVQRDHIQLMKNLKRLLRGNGTIVFS
NNKRHFKMDVDALNELGLRAENISSQTLPLDFTRNKHIHNCWIITHQG
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgaatcagtatttagccgtcacttctaacggacttgaaaacctgcttgttgacgaactt
aaaacgctagggattagcgatccaaaacctgtacaggcaggtgtgaaattcaaagcaacc
aatgctcaaatttaccgcgtctgtttatggagtaggttagcttcgagattcgttcgcata
cttgctgaattcaattgccaggacgatatggatttatacctgtctgtgaccgctgtgaat
tgggcttctcactttgatagcaacaagacgtttgttgtggatttcaatggtacaaataga
gagattcgcaacagtcagtatggtgcgttaaaagttaaagacggaatcgttgattccttt
aacaagaaaaaccttcctcgtccctcgatccgcaaagatcaaccagatcttcgtgttcat
gtgcgtctatttaaagacaaagcgctggtgggcttcgatatggtgggctccggtttgcat
cacagaggctatcgtactgagtctggtcgtgcccctttacgtgaaacgctcgcggcggcg
attatctcgcgctgtggctgggaacagggcatgccactgctagaccctatgtgtggctcg
ggaacattactgattgaagccgcaatgattgctgccaatatggcacctggtgttcaccgc
aaatactggtgttttgaatcactgaaagactttgaaccggaaacgtgggctgagatcaaa
tctgaagcgaacgtacaagcgcgcagaggcaccaaaaaggtggaatctaagttctatggc
tttgataacgatacccgcgttctgaaaacagcgcgtgaaaatgcaaaacgtgcgggtgta
gagtctctgattcacttcgagaaaggggacgcggctcagatcaagcgcccgggatcgttt
gataacggcatgattgtctctaacccgccgtatggtgagcgtttgggtactcaccctggt
ctaatcgcactttacacagcctttggtggtcaacttaagactgaattcggaggctgcaaa
gcgtccatcttctcctcttcagatgaattactgagttgtttgcgaatgagagccgacaag
cagttcaaattgaataatggtgcgttacagtgtcaccaaaaaaattatagcatctcagag
cgtgcgccgggtgatacagctaaagcagcagacagcgagactctgattgcgcctgatttc
gcaaaccgtcttaagaaaaacctgggtaagctaggtaagtgggcgcgtaaagaaaaactg
gactgctatcgggtctacgatgcggatctacctgaatacaacgcagcgatcgatatctat
caggatcatgttgtgattcaggagtatgctgcccctaagaacattcctgaagagaaaacc
aaacgtcgtctaaccgatatgatccgcgcaaccattcaggttacaggcgtggaggcaaac
aacgttgttcttaaagtccgagagaagaagaaaggcagcagccagtatcagaagctgagt
caggattcggaattcatgcaggtaaccgagtatggcgtagaactactggtcaacctccac
gactatctcgataccgggttgttcctggatcacaagcttacacgtcgcaaactaggtcag
atggcagggggtaaggatttccttaatctttttgcttataccggctctgcaaccgttcat
gccgcttgtggtggagcaaaatctacaacaactgtcgacatgtcgaaaacctatcttgaa
tgggctcaggagaacctgaacatcaatggcttgggtggcaatgagcacgaattcattcag
gcggactgtctgcaatggttagagcaggcggatgaagactttgatctgatattcatcgat
ccaccaacgttctctaactctaagcgcatggagcagtcattcgatgttcagcgtgatcat
attcaattaatgaaaaacctaaagcgtctgttacgtggtaacggaaccatcgttttttca
aacaacaagcgtcatttcaaaatggatgtggacgcactcaacgaacttgggttaagggca
gaaaacatttcttcgcagaccttgccactggatttcacgcgtaacaagcacattcacaat
tgctggatcatcactcatcaaggataa

DBGET integrated database retrieval system