KEGG   Vibrio nigripulchritudo: VIBNI_A2139Help
Entry
VIBNI_A2139       CDS       T02871                                 

Definition
(GenBank) putative Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni00473  D-Alanine metabolism
vni01100  Metabolic pathways
vni01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VIBNI_A2139
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VIBNI_A2139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vni01011]
    VIBNI_A2139
Enzymes [BR:vni01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VIBNI_A2139
Peptidoglycan biosynthesis and degradation proteins [BR:vni01011]
 Precursor biosynthesis
  Racemase
   VIBNI_A2139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: CCO58219
UniProt: U4K6E5
LinkDB All DBs
Position
1:2282306..2283532
Genome map
AA seq 408 aa AA seqDB search
MKTKLTLLALSLAATTAISTPAVSAPLLSGIEGEYNREHRTSNAWLEVSLSQFNDNIDQF
RTHVGSGTSICAVMKADAYGNGIQGLMPTIMAQGIPCVAIASNEEARIVRESGFNGQLIR
VRSASNKEIADAIQYEVEELVGSLSKARQIERIAERFDAEINVHLALNSGGMGRNGLDMS
TERGQRDALKMTDFDNVEIVGIMTHFPNYEVDYIREKAADFEKSALWIIENSDLDREDVT
LHAANSFTSLNVPEAQFDMVRPGGVLYGDLPGHAEYPSIVSYKTKVASLHRLPAGSTVGY
DSSFVTQRDSVLANLPLGYSDGYNRSLGNKGEVIIQGKRVPVVGKISMNTTMVDVTDIEG
IRQNAEVVLFGEQGKEAVTISEIETHTDMIFPEIYTIWGNSNPRRYVR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaacttacgcttcttgccctttctcttgctgctacaacggcgatttcgacg
ccagcagtgagtgctcccctgctttctggtatcgaaggtgaatacaaccgcgaacacaga
accagcaacgcatggctggaagtcagcttgtctcagttcaacgacaacattgaccagttc
cgcacgcacgttggttccggtacaagcatctgtgcagtaatgaaggctgatgcttacggc
aatggtattcagggtctgatgcctactattatggctcaaggtatcccatgtgtagctatc
gcaagcaacgaagaagcgcgtattgttcgtgaatcaggcttcaacggtcagctaattcgc
gtgcgttctgcaagcaacaaagaaattgccgacgcaattcagtacgaagtagaagagctt
gttggttctctgtctaaagcgcgccagatcgagcgtatcgcagagcgcttcgacgctgag
atcaacgttcaccttgctctgaactctggtggtatgggtcgtaatggtctggacatgtcg
acagagcgtggtcagcgtgacgcacttaagatgacagatttcgacaacgttgaaattgtt
ggcatcatgactcacttccctaactacgaagtggactacattcgcgaaaaagcagcggat
tttgagaaaagtgcactttggattatcgaaaactctgatctggaccgtgaagacgttact
ctgcatgctgcaaactcgttcacgtctctaaacgttccagaagcacagttcgacatggtt
cgccctggtggcgttctgtacggtgatctgcctggacacgcagagtacccatcaatcgta
agctacaaaaccaaggtagcatctctgcaccgcctgccagcaggcagcacggttggttac
gatagctctttcgttacgcaacgtgacagcgttctggctaacctgcctcttggatactca
gacggttacaaccgtagcctgggtaacaaaggggaagtgatcatccaaggcaagcgcgta
ccagtggtaggtaaaatctcaatgaacaccaccatggtagacgtaacagacatcgaaggc
atccgtcaaaatgctgaggtagttctgtttggtgaacaaggtaaagaagcggtgactatc
agtgagatagaaacgcacaccgacatgattttcccagagatctacaccatttggggtaac
tcaaaccctcgccgctacgtgcgttaa

DBGET integrated database retrieval system