KEGG   Vibrio nigripulchritudo: VIBNI_A2279Help
Entry
VIBNI_A2279       CDS       T02871                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni00240  Pyrimidine metabolism
vni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vni00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    VIBNI_A2279 (tdk)
Enzymes [BR:vni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VIBNI_A2279 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 AAA_30 AAA_19 DUF4528
Motif
Other DBs
NCBI-ProteinID: CCO58351
UniProt: U4K6W7
LinkDB All DBs
Position
1:complement(2428874..2429452)
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMNPMIYTAALDNRYGIGKVSSRIGLQSEAQ
LFHHETDLFEEIKKHNEEQKRHCILVDECQFLSKAQVYQLTEVVDKLGIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGNAIAEGDQVAIGGNDRYVS
VCRKHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaaatgtatttttattactcagcgatgaacgcgggtaaatctacaacactttta
cagtcctcttttaactatcaagagcgtgggatgaatccgatgatttataccgcagcactg
gacaaccgctacggaataggaaaggtaagctctcgaatcggtttgcaatctgaagcccag
ttatttcatcatgaaacggatttgtttgaagaaataaagaaacacaatgaagaacaaaaa
cgccattgtattcttgtggatgagtgtcagttcctgtcaaaagctcaagtttatcagcta
acagaagtcgttgataaattaggtattcctgtactgtgttatggcttgagaacagacttt
ctaggggagctgtttgaaggcagtaaatacctgctttcatgggcagacaaactagtagag
ctgaaaaccatctgtcattgcgggcgtaaagcgaacatggtgattcgaacggatgagcat
ggtaatgccattgcagaaggcgaccaagtagcaataggcggaaacgaccgttacgtatct
gtctgccgcaagcactacaaagaagcgttaggtaagtaa

DBGET integrated database retrieval system