KEGG   Vibrio nigripulchritudo: VIBNI_A3596Help
Entry
VIBNI_A3596       CDS       T02871                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni00620  Pyruvate metabolism
vni00680  Methane metabolism
vni01100  Metabolic pathways
vni01120  Microbial metabolism in diverse environments
vni01200  Carbon metabolism
Module
vni_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBNI_A3596 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    VIBNI_A3596 (ppc)
Enzymes [BR:vni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VIBNI_A3596 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 EcoR124_C
Motif
Other DBs
NCBI-ProteinID: CCO59569
UniProt: U4KHH5
LinkDB All DBs
Position
1:3788791..3791424
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVSMLGRLLGNTIQDAHGEAILEKVETIRKLSKSAMAGGQEDRENLIKEI
ESLPDEQLTPVARAFNQFLNLTNMAEQYHTISRHCEEHVCEPDALNSLFSKLSQNSISKL
DTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSYKERQKTERRLEQ
LIAQAWHSDVIRQQRPTPLDEAKWGFAVVENSLWQGVPDFLRELDEKLEGYLDEGLPIDA
RPVHFSSWMGGDRDGNPFVTHTITREVMLLSRWKAADLYLNDINELVSELSMTKCSDVLR
ELAGEGQHEPYRAILKRIRDVLTETRDILEAKINGEQLAVKAPLKSVDQLWEPLHACYQS
LHECGMGVIADGSLLDTLRRIKAFGIHLVRLDIRQESTRHSDVLSELTRYLGIGDYDQWS
EQDKVAFLTAELSSKRPLLPRDWEPSEPVKEVLDTCRIVASQPREAFGAYVISMARTASD
VLAVHLLLQESGCPYRMDVCPLFETLDDLNNAEAVITQLMGIDLYRGFIQNHQMVMIGYS
DSAKDAGVMAAGWAQYRAMEALVKVSEEAGIELTLFHGRGGTVGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPEVAVNSFNMYASAILEANLLPPPEPKQEWRDLMDVLSE
VSCEAYRGVVRGEPDFVPYFRAATPELELGMLPLGSRPSKRNPKGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSVDKGHQSLLEAMCREWPFFSTRLGMLEMVYSKCNIEISRLY
DQKLTDESLWPLGDKLRAQLQKDIKAVLNVENNENLMQSDPWGLESIRLRNIYVEPLNML
QAELLYRTRQTETPSSELEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaaatatgccgcgctaaaaagcaatgtgagcatgttaggtcgattgcttggc
aataccattcaagatgcacatggcgaagcgatcctagagaaagtagaaaccattcgtaaa
ctctcaaaatcagcaatggctggtggtcaggaagacagagagaacctcatcaaagaaatt
gagagtctgcccgatgagcaactgacaccagttgcccgcgcattcaatcagttccttaac
ctcactaacatggcagagcaataccacacgatttctcgccattgtgaggaacacgtctgt
gaaccagacgctttaaatagcttattctcaaaactcagccagaacagcatcagcaagctc
gacacggcacaagccgttcgtgacttaaacatagagcttgtgctgaccgcgcacccaact
gaaatcacgcgccgcaccatgatcaacaagctggtgaagatcaacgaatgcttgtcgaaa
ctggagctgagtgacctttcttacaaagagcgtcagaaaactgagcgccgtctggagcag
ttaatcgctcaggcatggcattctgacgttattcgtcagcaacgccctactcctttggat
gaagcgaaatggggctttgccgttgtagagaactctctgtggcaaggcgtacctgacttt
ctgcgtgaactcgacgagaagctggaaggctacctggatgaagggcttccaattgatgcc
cgcccagtgcacttttcttcctggatgggtggtgaccgagacggcaacccgtttgttacc
cacactatcacacgtgaagtaatgctgctctctcgctggaaagcggcggacctttacctg
aatgacatcaatgaactggtcagcgaactgtcgatgaccaagtgcagcgatgtgctacgc
gaactggcaggcgaaggacaacacgaaccttaccgcgccattctgaaacgcattcgcgat
gtgctgactgaaactcgtgacattcttgaagcaaaaatcaatggtgagcagttagcagtc
aaagcgccgcttaaatccgttgatcagctttgggaacctctacacgcgtgctaccagtca
ttgcatgagtgtggcatgggcgtcattgctgacggctctctgcttgatacacttcgtcga
atcaaagcgtttggtattcatctggttcgtctggacatccgacaggaaagtacccgtcac
tcagacgtactgtctgaattgactcgttatcttggtatcggagattacgatcagtggagc
gagcaggacaaagttgccttcctaaccgcagagctgagctctaagcgtcctcttcttcca
cgcgactgggaaccttcagaacccgttaaagaagtactggatacctgtcgtatagtggca
agccagccacgtgaagcattcggtgcttatgttatctcaatggcgagaaccgcatctgac
gttctggctgtgcatcttcttctgcaagaatcaggctgtccttaccgtatggacgtatgt
cccctgtttgaaacgctggacgatctgaacaatgcggaagctgtgattacccagctaatg
ggcatcgacctttaccgtggcttcatccagaaccatcaaatggtgatgattggctattcc
gattccgccaaagatgctggtgtaatggcagcaggctgggcgcaatatcgtgccatggaa
gctttggtgaaggtttctgaagaagcaggcattgagctgactctcttccacggacgtggc
ggtacagtgggtcgtggtggtgctcctgcacacgctgcactgctgtctcagccacctaag
agccttaaaggcggcttacgtgtaacggagcagggcgagatgattcgctttaagctgggc
ttgccagaagtcgcagtgaacagctttaacatgtatgccagcgcaattcttgaggcaaac
ctgttgccaccaccagagccgaagcaagaatggcgtgatctgatggatgtgctttcagaa
gtctcctgtgaagcttaccgaggcgtggtacgtggtgaacctgacttcgtcccttacttc
cgtgctgcgacgccagagctggaactgggcatgctgccactgggttctcgcccgtctaag
cgtaaccctaaaggtggagtagaaagcttgcgtgcgattccgtggattttctcatggagt
cagaaccgtcttgttcttcctgcgtggctaggtgctggtgaagccattcagtactcagta
gataaagggcatcaatcgctattggaagctatgtgtcgcgagtggccattcttctcgact
cgcttaggcatgctggaaatggtgtactcgaaatgtaacatcgaaatttcccgcctctac
gatcagaagctcacagacgaatcattgtggcctttaggcgataaactgagagctcaattg
caaaaagatattaaagctgttcttaatgttgagaataacgaaaacttgatgcaaagtgat
ccatggggattggaatctatacgccttcgcaacatctatgtagagccgttgaatatgcta
caagcagaactgctataccgcacaaggcagacagaaactccgtcatctgagcttgaagaa
gcattaatggtcacaattgctggtattgctgcaggaatgcgcaacaccggctag

DBGET integrated database retrieval system