KEGG   Vibrio nigripulchritudo: VIBNI_B0349
Entry
VIBNI_B0349       CDS       T02871                                 

Definition
(GenBank) putative Type VI secretion system-associated protein, VCA0119
  KO
K11910  type VI secretion system protein VasJ
Organism
vni  Vibrio nigripulchritudo
Brite
KEGG Orthology (KO) [BR:vni00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vni02044]
    VIBNI_B0349
Secretion system [BR:vni02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VIBNI_B0349
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: CCO60168
UniProt: U4KG98
LinkDB
Position
2:383116..384540
AA seq 474 aa
MDDKAIREKLRAPISEESPVGERVVDDPVFDFVESQMMKVGSLSHAEVRWAEVETGIISL
FEQKTKDLKLMTHLLQCFHHSNTVDRFCLSMQVVTDFMATYWETCYPAPGARGVLPRRKF
YSQIIQRFDTALEKLVKGTLPVTEQQSEAIGKAKIAWSDTAEKLSLDNDNFIAFIRKLER
WLESNKLQDLPSSAPVSSAESTSVSQSSGNAAVTPRAVEVDTGNEKAMKASLQKVADFLS
EFEYGHALSVRVRRFSVWSSITTPPDGDHKGETQLRAMVGERVSEYYEQLQRNPDLALWR
KVEQSLTIAPYWFDGQHLSAQIAAKIGQQSWADAILEETQNFLARIPELSGMSFKGGVPF
IGEDTRSWLKSNERVQTTSTVNSWDDKRQEAFVMAKEAGLSVAMAMLNEGLSAAKEPRDV
FYWRLLTADLLANNGLEAMAHQHYQSLYQSAIETKVEDWEPSLINQLQQFVVTE
NT seq 1425 nt   +upstreamnt  +downstreamnt
atggatgacaaagcgattcgggaaaaactccgcgcgcccatttcggaagagagtccggtg
ggtgagcgtgttgtggatgatccggtgttcgattttgttgaaagccagatgatgaaagtc
ggttcactctctcatgcagaagttcgctgggcagaagtggaaaccgggatcatttccctg
tttgagcaaaaaaccaaagatctgaaattgatgactcatctgttgcagtgttttcaccac
agcaacacggtggaccgattttgcctgtcgatgcaagtggtgacggactttatggcgacc
tattgggaaacttgctacccagcgcccggtgcgcgaggtgtgttaccgaggcgcaagttc
tacagccagattattcagcgttttgatacagcgttggaaaagctggtgaaaggcactctt
cctgtcactgaacagcagagcgaagccattggtaaagccaagattgcgtggagtgataca
gcagagaaactgtctctcgacaacgacaactttatcgccttcatccgaaagctggaacgt
tggttagagtcgaacaagctgcaagatctgccatcgtctgcgccggtttcttcggcagag
tcgacgtctgtttcccagtcttctggaaatgctgctgtaacgccaagagcagtcgaagta
gataccggcaacgaaaaagcgatgaaggcatcgttgcaaaaggtcgccgatttcctgagc
gaatttgaatacggtcatgcactgagcgttcgcgttcgtcgcttttccgtctggtcgtcg
atcacgacgccaccggatggtgaccataagggtgaaactcagcttcgcgctatggtgggg
gagcgagtgagtgagtattacgagcagttgcaacgtaaccccgatctggcgttgtggcgc
aaagtcgagcagagcttaaccatcgcgccttactggtttgatggtcagcatctaagtgcg
caaattgccgccaagatcggtcagcaaagctgggcagacgccattttggaagaaacccag
aactttctggctcgcatacctgaactgtcgggtatgagcttcaaaggcggcgtgcctttt
attggggaagacacccgaagctggcttaagtcgaatgagcgcgtgcaaaccacctctact
gtaaacagctgggatgacaaacgacaggaagcgtttgtgatggctaaagaagcggggttg
tccgtcgccatggcgatgcttaacgaaggtttatctgctgccaaagaaccacgagatgtc
ttttactggcggctgctaaccgccgatttattagcaaacaacgggctagaagcgatggcg
catcagcactatcaatccctttatcaatcggctatcgaaaccaaggtcgaagactgggaa
ccgtcgctcatcaatcaattacaacaattcgtcgtaacggaataa

DBGET integrated database retrieval system