KEGG   Vibrio nigripulchritudo: VIBNI_B1133Help
Entry
VIBNI_B1133       CDS       T02871                                 

Definition
(GenBank) putative D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vni  Vibrio nigripulchritudo
Pathway
vni00473  D-Alanine metabolism
vni00550  Peptidoglycan biosynthesis
vni01100  Metabolic pathways
vni01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VIBNI_B1133
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VIBNI_B1133
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VIBNI_B1133
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vni01011]
    VIBNI_B1133
Enzymes [BR:vni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VIBNI_B1133
Peptidoglycan biosynthesis and degradation proteins [BR:vni01011]
 Precursor biosynthesis
  Amino acid ligase
   VIBNI_B1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CCO60901
UniProt: U4KD10
LinkDB All DBs
Position
2:1162032..1163039
Genome map
AA seq 335 aa AA seqDB search
MTRKNILLLCGGGSNEHEVSLVSANYVQQQLQLDPSFNVIRVEMTKDEWRLSSGEKTELD
ISHSNLKGESHEIHIDYIVPCLHGFPGETGDVQSIFELAKIPYLGCGPEASISSFNKITS
KLWYDALGIPNTPYVFLSSNNEDAHEKARTAFEEWGVLFVKAARQGSSVGCYKVTESKEI
SEAVNKAFTFSDQVLIEKAVKPRELEVAAFEHNGELIISKPGEVIAPENGYYTYEEKYGA
DSHSLTVVEAEGLTDAQIEEIQSHSRKVFLQMGLKDLSRIDFFLTEDNEIYLNEVNTFPG
MTPISMFPKMVEHHGVSFKDFLSNAINNALSNPTA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaaaaacatccttttgctatgcggcgggggctcaaacgaacatgaagtctcg
ttagtttccgcaaactatgttcagcaacaacttcagttagatccaagcttcaatgtcatt
cgagttgaaatgactaaagatgagtggcgactaagctctggagaaaaaactgagctggac
atttcgcattcaaatcttaaaggtgaatctcacgaaattcatatcgactatatcgttcct
tgcctgcatggttttccgggcgaaactggcgatgttcagtctatctttgagctggcaaaa
attccatatcttggctgcggaccagaagcgagcatcagcagcttcaataaaattacctct
aagttatggtatgacgcattaggcattccaaacacgccatacgttttcctatcttcaaac
aatgaagatgctcatgaaaaggcaagaacagcatttgaagagtggggagtcttatttgta
aaggctgcgcgtcaagggtcttcggtcggatgttacaaggtcacggaatcgaaagaaata
agtgaagcagtaaacaaagcgttcactttctcggatcaggtattaatcgaaaaagccgtg
aaaccaagagagttggaagttgcagcgtttgaacataacggagaactgatcatctcgaag
cctggagaagtcatcgctccagagaatgggtactacacatacgaagaaaagtatggagca
gacagccattcactcacggtagttgaagcagaagggctgactgacgcacagatcgaagaa
attcagtcacattccagaaaagtctttcttcaaatgggtttgaaagatctctccagaatt
gatttcttcctaactgaggataatgaaatctacctaaacgaggtgaacaccttcccgggt
atgacgccaatctccatgttccctaaaatggttgaacatcatggcgtcagcttcaaggac
ttcttgagtaacgctataaacaatgctttatctaatcccacggcttga

DBGET integrated database retrieval system