KEGG   Vibrio neocaledonicus: D3H41_18340
Entry
D3H41_18340       CDS       T06228                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vnl  Vibrio neocaledonicus
Pathway
vnl00473  D-Alanine metabolism
vnl00550  Peptidoglycan biosynthesis
vnl01100  Metabolic pathways
vnl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vnl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    D3H41_18340
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D3H41_18340
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    D3H41_18340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vnl01011]
    D3H41_18340
Enzymes [BR:vnl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     D3H41_18340
Peptidoglycan biosynthesis and degradation proteins [BR:vnl01011]
 Precursor biosynthesis
  Amino acid ligase
   D3H41_18340
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 TTL ATPgrasp_ST DUF5435
Other DBs
NCBI-ProteinID: QCO87987
UniProt: A0A4P8G6M6
LinkDB
Position
2:complement(318359..319348)
AA seq 329 aa
MIKNILLLCGGGSSEHEISLLSANFVEQQLNLIEDVHVTRVEIKNEGWMTNQGELVYLDL
NTKQLCSSESNQTIDFIVPCIHGFPGETGDIQSLFEIAGIPYLGCGPEASSNSFNKITSK
LWYDAIGIPNTPYLFLTRNDEEAHVQAHKAFEKWGKVFVKAARQGSSVGCYSVTEKDKLS
NAVNDAFGFSDQVLVEKAVKPRELEVAAYEMNGQLHITKPGEVIAPDDAFYSYDEKYSSS
SHSLTEVEAKNLTQVQLDSIQHASETVFRQMNLRHLSRIDFFLTEDDEIYLNEVNTFPGM
TPISMFPKMLQNNGHKFHEFLEDCINSAK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgattaaaaatattcttttactatgcggcggtggctcttctgagcacgagatttcatta
ttgtctgcaaactttgtcgaacaacaactaaatcttattgaagacgttcacgttacacgc
gtagaaataaaaaacgaaggttggatgaccaaccaaggtgagttggtttacttggatctc
aataccaagcagttgtgctcaagtgaatctaatcaaaccattgatttcatcgtgccttgt
atacatggttttcctggcgaaacaggcgacattcaatctctgtttgaaatcgcaggtatt
ccttatcttggctgcgggccagaagcgagtagcaatagtttcaataaaatcacatctaag
ctttggtacgacgctattggcatacccaatacgccatacttattcttaacgcgaaacgat
gaagaagctcacgttcaagctcataaagcctttgaaaagtggggaaaagtttttgttaaa
gccgctcgccaaggctcttccgttggctgttacagtgtcacagaaaaagacaagctttct
aatgcagtaaatgatgcttttgggttttctgaccaagtgttggttgagaaagcagtaaaa
cctcgagaacttgaagttgctgcatatgagatgaatggccaactacatatcactaagcca
ggcgaggtcatcgcgcctgatgatgctttttactcgtacgatgaaaaatacagcagttca
agtcactcgctcacagaagttgaggcgaagaatctaactcaagtacaattagattccatc
caacacgcgtcagaaacggtatttagacaaatgaatctccgtcatttatctcgtatcgac
tttttcctaacggaagatgatgagatttacttaaacgaagtaaacacatttccaggaatg
actccgatctcaatgttccctaaaatgcttcaaaacaacgggcacaaatttcatgagttc
ttggaagattgtataaacagtgcaaagtga

DBGET integrated database retrieval system