KEGG   Vibrio neocaledonicus: D3H41_22770Help
Entry
D3H41_22770       CDS       T06228                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vnl  Vibrio neocaledonicus
Brite
KEGG Orthology (KO) [BR:vnl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D3H41_22770
Enzymes [BR:vnl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D3H41_22770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA FAD_binding_2 Glutaredoxin Thi4 HI0933_like FAD_binding_3 Thioredoxin_9 DAO Chalcone_N Shikimate_DH NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: QCO88809
UniProt: A0A4P8G7I4
LinkDB All DBs
Position
2:complement(1284320..1285888)
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEEVRLVVSLDESKASNDILSLANQIAEMSDLITVERDDNASA
RKPVMAVTNPAKGTALRFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKDLD
VEIFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGGLFQDEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDGASEKAAKALSEKAPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVAEQQAEKLMGAAHTE
DGLIHIQLKSGATLKSKSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKANSLPNIDIITMAQTTEVVG
DGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagaa
gttcgtttagtggttagtctagatgaaagcaaagcatccaatgacattttgtctctagcg
aaccaaatcgcagagatgagcgacctaatcaccgttgaacgtgacgacaacgcaagcgca
cgtaaaccagtgatggcggtaactaacccagctaaaggcacagcactacgctttgcaggc
ttgccaatgggtcacgaatttacctctctagtattggcactgcttcactctggcggtcac
ccaatcaaactagaaccagaagtgattgagcaaatcgcagcactagacaaagatctagac
gtagaaatcttcatttcactgtcgtgtcaaaactgtccggacgtggttcaagcgttcaac
atgatggcggcgatcaacccgaaagtaaaagcaaccatgatcgatggaggtttgttccaa
gatgaagtaaaacaacgcgacatcatggccgtaccaagcgtattcgtgaacggtgagcta
ttcggtcaaggccgtatgtctctgactgaaatcctaaacaaagtggatgacggcgcaagc
gagaaagccgcgaaagcactgagcgaaaaagccccatacgacgtgcttgttgttggcggt
ggtcctggtggtagcgcagctgctctatacgccgctcgtaaaggtattcgcactggcgtt
gttgctaaacgctttggtggtcaggttatggacaccatggcaatcgagaacttcatttcg
gtaaaacgtactgaaggtccaaaactggcaactgacctagcagaacacctaaaagaatac
gacgtagacgtagtagctgagcaacaagctgagaagctaatgggcgcagcacacacagaa
gatggcttgattcatatccaacttaaaagcggcgcaacgctgaaaagtaagagtgtcatc
ctaagccctggagctcgctggcgtgaaatgaacgttccgggtgagcaagagtaccgcaac
aaaggcgtcgcgtactgcccacactgtgatggcccgctattcaaaggcaagaaaaccgcg
gttatcggtggtggtaactcaggcatcgaagcggctatcgaccttgcaggtattgttgag
cacgtaacggttcttgaatttgcagacgtacttcgcgcagaccaggtacttatcgacaaa
gcaaactcactaccaaacatcgacatcatcacgatggcgcaaaccacagaagtagtgggt
gacggtactcgcgtaacaagcttgaagtacaaagaccgtaacacagatgaaatcaaagag
attgaactgtcaggtatctttgttcaaatcggtctagtaccaaacacagaatggctaaaa
gattcagaagtagcactatctgagcgcggcgaaattgaagtaggtagccgtggcgaaact
agcctagaaggtgtgtttgcagccggtgacgcaaccaccgttccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcatttgactacctaatccgtaag
caaggttaa

DBGET integrated database retrieval system