KEGG   Candidatus Vesicomyosocius okutanii (Calyptogena okutanii): COSY_0828Help
Entry
COSY_0828         CDS       T00530                                 

Definition
(GenBank) ribonuclease II family protein
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
vok  Candidatus Vesicomyosocius okutanii (Calyptogena okutanii)
Brite
KEGG Orthology (KO) [BR:vok00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vok03016]
    COSY_0828
Enzymes [BR:vok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     COSY_0828
Transfer RNA biogenesis [BR:vok03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    COSY_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: BAF61934
UniProt: A5CVS5
LinkDB All DBs
Position
complement(866152..867957)
Genome map
AA seq 601 aa AA seqDB search
MINALVSYKGKPARIIKQTIHKFVLEFADGSSRLVRAKDFRFIHSEFVQVDNTCTYADVS
VLEDLQEEVLTLEEVTQWLFDEYNAKNAWCSCVLIEDGLYFYWQKDKVFIRPTYQVESIR
TKRDAKIIETKNLKHCADNIANNILDKQDLPYIRDIEKVALNQSKHAKVLSNIGIENIPE
SAYRLLLNLNYFKPGFNPYPTRNNILKDDQIDASIVKVDRVDLTHLSSYAIDNFDSNDAD
DAISVDGDKIWIHIADVSLIATAGSELDSYAQKRASNLYLPEQIIHMLPISVTKMCALGL
TETSHALSIGFTLELGEINNVEVVRSIIKVTNISYDNADGMLVSNEYLSKLQSITKAHKQ
YRYKNGAISLNLPNVDIRFRQGQVLITQQRLSKSRELVAEMMVMAGRVVAQFAVDNNIVM
PYTIQDKGGFSQEILDNQDTLSLSESFKATKFFKRSATSIKNLPHFGLGVKAYLRITSPL
RRYLDLFAHQQLSRFIKGEDTLNKEDVKKIIGIHNTTMSSVGRTIRSSNDHYKCVYLLDN
PLWQGDSFVVDIRGNKTLLMIPELGMITQIRFKILPKLDEKITLKVTTVDLVDCSANFKS
I
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
ttgattaacgctttagtatcctataaaggtaagcctgcacgtattattaagcaaacgata
cataaatttgtactagagtttgctgatggttcttcgcgcttggtacgagcaaaagatttc
cgttttattcattctgaatttgtccaggtagataacacgtgtacatatgcagatgtgtct
gtacttgaagatctacaagaagaagtattaacattagaagaagtaacgcaatggttattt
gatgagtataatgctaaaaatgcttggtgtagttgtgttttaattgaagatgggttgtat
ttttattggcaaaaagacaaagtttttatacgcccaacttaccaagttgaaagtatccga
actaaacgtgatgctaaaattattgagactaagaatcttaagcattgtgcggataatatt
gctaacaatatattggataaacaagatttaccctatattagggatattgagaaagtggcg
ttaaatcaatctaagcatgctaaggttttatctaatattggtatagaaaatatacctgaa
tctgcctatagattgttattaaatctgaattattttaagccaggttttaatccttatcca
actcgtaataatattcttaaagatgatcaaattgatgctagtatagtgaaagttgatcgg
gttgatttaacgcatttatctagttatgcaattgataattttgattcaaatgatgctgat
gatgcaattagtgttgatggcgataagatttggattcatattgctgatgtatctttgatt
gctaccgctggttctgagttggattcttatgcacaaaagcgtgcttctaatttatattta
cctgagcaaattatccacatgttacctatttctgtgactaagatgtgtgcattgggattg
accgaaacatcacatgctttgtcgatagggtttactttagaattaggtgagattaataac
gttgaagtggttcgtagtataattaaagtgactaatattagttatgataatgcagatggg
atgttggtctctaatgaatatttatcaaaattacaaagcatcacaaaagcacacaaacaa
tatagatataaaaatggtgcaattagtttaaatttgcccaatgttgatattaggtttagg
cagggccaagtgttaattacacaacaaagattaagtaaaagtcgtgaattggtggccgaa
atgatggtgatggctggtcgtgttgttgcacaatttgctgttgataataatattgttatg
ccttatacaattcaagataaaggagggttttcacaagaaatattagataatcaagacaca
ttatctttatctgagtcatttaaagctacaaagttttttaaacgctcagctacatctatc
aagaatttaccacattttggtttaggagttaaggcatatttacgtattactagtccactt
agaaggtatcttgatttattcgcacatcaacagcttagtcggtttattaaaggtgaagat
acattaaacaaggaggatgttaaaaagattattggtattcataatactactatgtctagt
gttggtaggacaatacgttctagtaatgaccattataaatgcgtttatctacttgataat
ccattatggcaaggtgatagttttgtagtggatatacgcggtaataaaacattgcttatg
attcctgaattaggtatgataactcagattaggtttaaaattttgcctaagctagatgaa
aaaataacactaaaagtaacaactgttgatttagttgattgtagtgctaattttaagtcg
atttag

DBGET integrated database retrieval system