KEGG   Vibrio owensii: A9237_01770Help
Entry
A9237_01770       CDS       T04844                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vow  Vibrio owensii
Pathway
vow00250  Alanine, aspartate and glutamate metabolism
vow00410  beta-Alanine metabolism
vow00430  Taurine and hypotaurine metabolism
vow00650  Butanoate metabolism
vow01100  Metabolic pathways
vow01110  Biosynthesis of secondary metabolites
vow01120  Microbial metabolism in diverse environments
vow02024  Quorum sensing
Module
vow_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A9237_01770
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9237_01770
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A9237_01770
   00430 Taurine and hypotaurine metabolism
    A9237_01770
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    A9237_01770
Enzymes [BR:vow01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     A9237_01770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2 DegT_DnrJ_EryC1 AAA_33 DUF5446
Motif
Other DBs
NCBI-ProteinID: AQW56909
LinkDB All DBs
Position
1:404059..405705
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTIPEGPDSTLTKIDESLSQNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQDDKFYRKWMHSAKHSLGAFCSGGTIANITA
LWVARNKALKADGAFKGVEKEGLFKAMKHYGYEGLAILVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVDDLKAKIAELESQNIKPIAVVGVAGTTETGSVDPLPQIAEVCAEHN
CHFHVDAAWGGATLMSNNHRHLLGGVELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
INQQEDFELVSEPELCLLTYRYLPTNMRAALDKAQGVQKEKLNELINQLTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTNDILSAVLSEQREIAQQAPSLMAKIEE
TVDDILNS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagcttcgagagcttgttaaagatcttcact
atccctgaaggtccagattcaacgttgactaaaattgatgaaagtctttcgcagaacttg
aatcaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgtgaaattgagaaa
gacttttcttctgctcagattcctgagcaacctgagttcgtgtcagaccataccgagcac
ctgctagataccttggtatctcactcggttcacacctctgcaccaagctttattggtcac
atgacttctgctctgccgtatttcttaatgccgctgtcgaagatcatgattgccttgaac
caaaacttggtgaaaatcgaaacatcaaaagctttcacaccgcttgagcgtcaagttctt
ggtatgttgcatcgccttatctatggtcaggacgataagttctaccgtaaatggatgcac
agcgcgaaacactctctcggtgcattttgctccggcggcaccatcgctaacatcactgcg
ctttgggttgctcgcaataaagcactgaaggctgatggcgcattcaaaggtgtagaaaaa
gaaggtctgttcaaagccatgaaacattatggctacgaagggttagcaattttggtttct
gaacgaggtcactactcactgaagaaagctgcagacgttcttggccttggtcaagagggc
ctagttgccgtcaaaacagacgccaacaaccgcatcattgttgacgacctaaaagcaaaa
atcgccgagctcgaatcacaaaacatcaagcctatcgctgtggttggtgttgcaggtaca
acagagactggcagcgttgacccactacctcaaattgcagaagtatgtgctgagcacaac
tgccacttccacgtggatgcagcttggggcggcgcgactctgatgtcgaacaatcatcgt
cacctacttggtggcgttgaacttgccgactctgtaacgatcgatgctcacaaacagctt
tacattccgatgggcgcaggcatggttctgtttaaagatccagatgcgatgaagtctatc
gagcatcatgcacagtacatcttgcgtaaaggttctaaagacttaggcagtcatacgctt
gagggttctcgctctggtatggcaatgttggtttacgcagcaatgcacattatcagtcgc
ccaggttacgagcttctgatcgaccaaagtattgagaaagcacgttacttcgctgatctg
attaaccaacaagaagacttcgaattggtgtctgagcctgaactttgtttgttaacttac
cgctatctgccaaccaatatgcgcgcggcattagacaaagcacaaggcgttcagaaagaa
aaacttaatgagctaatcaaccaactcactcagtttattcagaaacgtcagcgtgaaact
ggtaagtcgtttgtctctcgtactcgactgaatccagaccaatggcaacgcatgaacacc
attgtattccgcgtcgttcttgctaacccattaaccaccaatgatatcttgagcgcggtt
ttgagtgagcaaagagaaattgctcagcaagcaccgagcttgatggctaagattgaagaa
actgtcgacgacattctcaattcttag

DBGET integrated database retrieval system