KEGG   Vibrio owensii: A9237_02180Help
Entry
A9237_02180       CDS       T04844                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
vow  Vibrio owensii
Pathway
vow00240  Pyrimidine metabolism
vow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A9237_02180
Enzymes [BR:vow01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A9237_02180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: AQW56991
LinkDB All DBs
Position
1:complement(502817..503395)
Genome map
AA seq 192 aa AA seqDB search
MAQMYFYYSAMNAGKSTTLLQSSFNYQERGMTPVIFTAALDDRYGVGKVSSRIGLQSDAH
LFRPDTNLYQEIAALHEVEKRHCILIDECQFLSKEQVYQLTEVVDKLHIPVLCYGLRTDF
LGELFEGSKYLLSWADKLVELKTICHCGRKANMVIRTDEHGVAIKEGDQVAIGGNDRYVS
VCRQHYKEALGK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggctcagatgtatttctattactcggcaatgaatgcgggtaaatcgacaactcttctt
caatcttcatttaactaccaagaacgtggcatgacgcctgtgattttcacagcagcgtta
gatgatcgctacggtgtaggtaaagtgagctctcgtattggtttgcaatcagacgcgcat
ttgttccgtccagataccaacctttaccaagagattgcagcactgcatgaagttgaaaaa
cgtcactgtatcctaattgatgagtgccagttcttgtcgaaagaacaggtttaccaacta
acagaagtagttgataagctgcatatcccggtactttgctatggtcttcgtaccgatttt
ctaggcgaactttttgaaggcagcaagtacctattatcatgggcagacaaattggttgaa
ctaaaaacgatttgtcactgtggtcgcaaggcaaacatggttatccgtactgatgagcac
ggcgttgcaatcaaagaaggtgatcaagtcgcgattggcggtaacgaccgttacgtatcg
gtttgtcgtcagcactacaaagaagcacttggtaagtaa

DBGET integrated database retrieval system