KEGG   Vibrio owensii: A9237_03715Help
Entry
A9237_03715       CDS       T04844                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
vow  Vibrio owensii
Pathway
vow00220  Arginine biosynthesis
vow00250  Alanine, aspartate and glutamate metabolism
vow00290  Valine, leucine and isoleucine biosynthesis
vow01100  Metabolic pathways
vow01110  Biosynthesis of secondary metabolites
vow01130  Biosynthesis of antibiotics
vow01210  2-Oxocarboxylic acid metabolism
vow01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9237_03715
   00290 Valine, leucine and isoleucine biosynthesis
    A9237_03715
   00220 Arginine biosynthesis
    A9237_03715
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vow01007]
    A9237_03715
Enzymes [BR:vow01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     A9237_03715
    2.6.1.66  valine---pyruvate transaminase
     A9237_03715
Amino acid related enzymes [BR:vow01007]
 Aminotransferase (transaminase)
  Class I
   A9237_03715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AQW57277
LinkDB All DBs
Position
1:860492..861706
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGD
EMLIPAPDYPLWTASVALSGGKPVHYICDEGADWYPDLEDIKKKITPKTRGIVLINPNNP
TGAVYSRDFLLEVIEIARQHNLIIFADEIYDKVLYDGATHTSVATLTEDVLVMTFNGLSK
AYRVCGFRGGWMFLTGPKHLAQGYINGLELLSSMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRNRAYELINQIPGVSCVKPKGAMYLFPKIDTKMYNIKNDQQMVLDFLKQEK
VLLVQGSGFNWPKPDHFRIVTLPHVEDLETAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctacgacattaggggtcct
gtactcaaacatgctaagcgcatggaggaagaagggcataaaatcctaaagctaaacatt
ggtaaccccgccccatttggttttgacgcccctgatgagattttagtagatgtaatccgc
aatctaccaacttctcaaggctactgtgattccaaaggcatctactctgcgcgtaaagcc
gttgtacaacattaccaacgtaaaggcatccgctcactagatgttgaagatgtatacgta
ggtaacggcgtttcagagctaatcgtgatggcaatgcaagcgctattgaacaatggcgat
gaaatgctgatcccagcaccagactacccactgtggaccgcatctgttgctctgtctggt
ggtaaacctgtgcattacatctgtgatgaaggcgcagactggtatcctgatctagaagac
atcaaaaagaaaatcaccccaaaaacgcgtggtattgttctgatcaacccaaacaaccca
acgggtgcggtatacagtcgtgattttctactagaagttatcgagattgcccgccaacac
aacctgatcatcttcgctgacgagatctacgacaaagtgctttacgacggagcaacacac
acctcagtcgcgaccctaacagaagatgtgctagtgatgaccttcaacggtttatcaaaa
gcataccgtgtttgtggcttccgtggcggctggatgttcctaaccggccctaaacatctg
gcgcaaggttacatcaatggtcttgagcttctttcgtcaatgcgtttgtgcgccaacgta
ccgatgcaacacgcgattcaaaccgcattgggtggctaccaaagtattaatgagctgatc
ttgccgggtggtcgtttgcttgaacaacgtaaccgtgcttacgagctgatcaaccagatc
cctggggtttcttgtgtgaaaccgaaaggtgctatgtacttgttcccgaaaatcgacacc
aaaatgtacaacattaagaatgaccagcagatggtgctcgatttcttgaagcaagaaaaa
gtgctactcgtacagggctcaggctttaactggccgaaaccggatcacttccgtatcgtt
accctgccgcacgtagaagatcttgaaaccgcgattggccgctttgagcgtttcctatca
acgtatagccagtag

DBGET integrated database retrieval system