KEGG   Vibrio owensii: A9237_04060Help
Entry
A9237_04060       CDS       T04844                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vow  Vibrio owensii
Pathway
vow00020  Citrate cycle (TCA cycle)
vow00190  Oxidative phosphorylation
vow00650  Butanoate metabolism
vow01100  Metabolic pathways
vow01110  Biosynthesis of secondary metabolites
vow01120  Microbial metabolism in diverse environments
vow01130  Biosynthesis of antibiotics
vow01200  Carbon metabolism
Module
vow_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vow_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vow_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A9237_04060 (sdhB)
   00650 Butanoate metabolism
    A9237_04060 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A9237_04060 (sdhB)
Enzymes [BR:vow01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A9237_04060 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A9237_04060 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer2 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AQW57342
LinkDB All DBs
Position
1:complement(945846..946556)
Genome map
AA seq 236 aa AA seqDB search
MKLNFSLYRYNPDVDQKPYMKDYTLEVEEGSDMMLLDALILLKEQDPSIAFRRSCREGVC
GSDGLNMNGKNGLACITPLSALQGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLI
DDGALPPSRENLQTPDERAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWL
IDSRDTATDERLSDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLVNRSI
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaatttctctttgtaccgctacaatccggatgtcgaccaaaagccgtacatg
aaagactacacgcttgaggtggaagaaggatcagacatgatgcttctggatgcattgatc
cttttgaaggagcaagaccctagcattgcattccgtcgttcatgccgcgaaggggtatgc
ggctctgacggcctaaacatgaatggcaagaatggtctagcgtgtattacaccgctatct
gcactgcaaggtgacaagattgtcattcgtcctctaccgggcctaccagtagtgcgtgat
cttatcgttgacatgacacagttctacgataactatgcgaaagttaagcctttcttgatt
gatgatggtgctctacctccatctcgcgagaacttacaaacgcctgatgagcgtgcgcat
ttagatgggctgtacgaatgtattatgtgtgcatgttgtacaacttcttgtccatcattc
tggtggaacccagataaatttatcggccctgctggtcttctagcagcttaccgttggcta
attgatagccgagatacggcaactgatgaacgtttgtccgatcttgatgatgcatttagc
gtttttcgttgccatggcatcatgaattgtgtaagtgtttgtcctaaggggctaaatcca
acgaaagctatcggtcacatcaagtcgatgctagtcaatcgttcgatttaa

DBGET integrated database retrieval system