KEGG   Vibrio owensii: A9237_04065Help
Entry
A9237_04065       CDS       T04844                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vow  Vibrio owensii
Pathway
vow00020  Citrate cycle (TCA cycle)
vow00190  Oxidative phosphorylation
vow00650  Butanoate metabolism
vow01100  Metabolic pathways
vow01110  Biosynthesis of secondary metabolites
vow01120  Microbial metabolism in diverse environments
vow01130  Biosynthesis of antibiotics
vow01200  Carbon metabolism
Module
vow_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vow_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vow_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A9237_04065
   00650 Butanoate metabolism
    A9237_04065
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A9237_04065
Enzymes [BR:vow01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A9237_04065
    1.3.5.4  fumarate reductase (quinol)
     A9237_04065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like Thi4 FAD_binding_3 DAO BEX Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AQW57343
UniProt: A0A3G2QBB8
LinkDB All DBs
Position
1:complement(946575..948341)
Genome map
AA seq 588 aa AA seqDB search
MSIPVREFDAVVIGAGGAGMRAALQISEQGLSCALLSKVFPTRSHTVSAQGGITVALGNA
HEDHWEQHMYDTVKGSDYIGDQDAIEYMCKNGPESVIELEKMGLPFSRFDNGTIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNIKHKTTVFSEWYALDIVKNEDGVVLGC
TALCMETGEVCYFKSKATILATGGAGRIYASTTNAHINTGDGVGMALRAGVPMQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSMMIEIREG
RGCDGPWGPHIKLKLDHLGKDTLESRLPGVCELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTQVSGQAIRQDENGADVEVQGLFACGEIASVSVHGANRLGGNSLLDLVVFGRATGLHLG
ETLLKQADAKPATEADIERSLERYNRWENSTDGEDPAQIRKDLQQCMQNNFSVFREGDAM
AKGLVELKAIRERLKNAHLADKSTEFNTQRIECLELENLMETAYATAVAANYRTESRGAH
ARFDFPDRDDEQWLCHSIYNPETEAMTKRGVNMEPIHREAFPPKARTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
gtgtctattccagttcgtgagtttgacgccgtagtaatcggcgctggtggtgcgggcatg
cgcgctgcactacaaatttcggagcaaggcctttcttgtgcgttgctatctaaagttttc
ccaacacgttcacacactgtttctgctcaaggtggtattacggttgcgctaggtaatgcg
cacgaagaccattgggaacagcacatgtacgatacggttaaaggttctgactatatcggt
gaccaagacgcaatcgagtacatgtgtaagaacggtcctgaatctgttatcgagctagag
aaaatgggtcttcctttctctcgttttgataacggcactatttaccaacgcccgtttggt
ggccagtcaaagaactttggtggtgagcaagcggcacgtaccgcggcagcggctgaccgt
actggtcacgcacttctgcacacgctttaccaacaaaacatcaagcacaaaacaacggta
ttctctgagtggtatgctcttgatatcgttaaaaatgaagatggtgttgttctaggctgt
actgcgctatgcatggaaacgggtgaagtgtgctacttcaaatcgaaagcaacgatctta
gcaactggtggtgcaggtcgtatctacgcatcaacaactaacgcgcacatcaatactggt
gatggtgttggtatggcacttcgtgcgggcgttccgatgcaagatatggaaatgtggcag
ttccacccaacgggtatcgctggcgcaggtgtgcttgtaaccgaaggttgtcgtggtgag
ggtggttaccttctaaacaaagatggtgaacgcttcatggagcgctacgcaccaaacgcg
aaagaccttgctggtcgtgacgtggttgctcgttcaatgatgattgaaatccgtgaaggc
cgcggctgtgatggtccttggggtccacacattaaactgaaacttgatcacctaggtaaa
gatactctggagtctcgtctaccgggtgtttgtgagttgtctcgtacatttgcgcacgtt
gatccggtcaaagagccaatccctgtaattcctacgtgtcactatatgatgggtggtatc
cctactcaggtatcaggccaagcgattcgccaagatgagaatggcgctgacgttgaagtt
caaggtctatttgcttgtggtgagattgcttctgtatcggtacacggtgcaaaccgtcta
ggtggtaactcactgcttgaccttgtggtatttggtcgtgcgacgggccttcatctgggt
gaaacactgcttaaacaagctgacgcgaaacctgcgacagaagctgatattgaacgttca
ctagagcgttacaaccgttgggaaaatagcactgacggtgaagatccagcgcaaattcgt
aaagacctacaacagtgtatgcaaaacaacttctcggtattccgtgaaggtgatgcaatg
gcaaaaggtctggtagagctgaaagctatccgtgaacgtctgaaaaacgctcaccttgct
gataagtcgactgagttcaacacacaacgcattgagtgtcttgaactagaaaacttgatg
gaaactgcttatgcaacggcggttgcggctaactaccgtacagaaagccgtggtgcgcat
gctcgctttgacttccctgaccgtgatgatgagcagtggctatgtcactctatctacaac
ccggaaacggaagcaatgacgaaacgtggtgtaaacatggagccaatccatcgtgaagca
tttccgccaaaagcacgtacgtactaa

DBGET integrated database retrieval system