KEGG   Vibrio owensii: A9237_09905Help
Entry
A9237_09905       CDS       T04844                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
vow  Vibrio owensii
Pathway
vow00620  Pyruvate metabolism
vow00680  Methane metabolism
vow01100  Metabolic pathways
vow01120  Microbial metabolism in diverse environments
vow01200  Carbon metabolism
Module
vow_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A9237_09905
  09102 Energy metabolism
   00680 Methane metabolism
    A9237_09905
Enzymes [BR:vow01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A9237_09905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF349
Motif
Other DBs
NCBI-ProteinID: AQW59614
LinkDB All DBs
Position
1:complement(2166435..2169068)
Genome map
AA seq 877 aa AA seqDB search
MNEKYAALKSNVRMLGHLLGNTIRDAHGEEIFEKVETIRKLSKSAQAGNNADRDSLIEEI
KSLPDEQLTPVTRAFNQFLNLTNIAEQYHTISRHCEEHICEPDAINSLFSKLVQNDVSKL
DTAQAVRDLNIELVLTAHPTEITRRTMINKLVKINECLSKLELSDLSFKERKKTERRLEQ
LIVQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLREMNDRLKSYLGEGLPIDA
RPVHFSSWMGGDRDGNPFVTHSVTREVLLLSRWKAADLYLNDINELISELSMTVCNDKVR
ELAGDDQHEPYRAILKQLRSLLNETKDILDAKVHGQKLAVKAPLQKVEQLWEPLYACYQS
LNECGMGVIANGSLLDTLRRVKAFGIHLVRLDIRQESTRHADVLSELTRYLGIGDYEQWS
EQDKVAFLTNELASKRPLLPRDWEPSEPVKEVLDTCKIVAAQPREAFGAYVISMARTASD
VLAVHLLLQEAGCPYRMDVCPLFETLDDLNNAEAVIKQLMGIDLYRGFIQNHQMVMIGYS
DSAKDAGVMSAGWAQYHAMDSLVKVAEEEGVELTLFHGRGGTIGRGGAPAHAALLSQPPK
SLKGGLRVTEQGEMIRFKLGLPDVAVNSFNLYASAILEANLLPPPEPKQEWRDLMDVLSE
VSCEAYRSVVRGEPDFVPYFRQATPELELGKLPLGSRPAKRNPNGGVESLRAIPWIFSWS
QNRLVLPAWLGAGEAIQYSVDKGHQALLEEMCREWPFFSTRLGMLEMVYTKCNMEISRYY
DQRLVETPLQPLGDRLREQLQRDIKSVLNVENNENLMQSDPWGQESIRLRNIYVEPLNML
QAELLYRTRQTEEASANLEEALMVTIAGIAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaatacgccgcactaaaaagtaatgtgcgcatgttgggccaccttctgggt
aacacaattcgtgatgctcatggcgaagaaatcttcgagaaagtggaaaccattcgtaaa
ttatccaaatcggctcaagctgggaataatgctgacagagacagcttaatagaagaaatt
aaaagcctaccagatgagcaattaacgcccgtgacccgtgcgttcaaccaatttctaaac
ctgaccaatattgctgagcaataccacaccatttcacgccattgtgaagagcacatctgc
gaacctgacgcaattaactcgctgttctcaaagctagtgcaaaatgatgtgagcaagcta
gacacggcacaagcggttcgcgacctgaacattgaattggttctaactgcacacccaacc
gaaatcactcgtcgcaccatgatcaacaaactggtgaagatcaacgagtgtttatccaag
ctagagctgagcgatctctctttcaaagagcgtaaaaaaactgaacgtcgccttgagcaa
cttatcgttcaaagctggcactctgacgttatccgtcagcagcgtccaacgcctcttgat
gaagctaagtggggctttgcggttgtagagaactcactatgggaagccgtacctgatttc
ctacgtgaaatgaacgaccgtctgaagtcttatcttggcgaaggtctaccaattgatgcc
cgccctgtgcacttctcatcttggatgggtggtgaccgtgacggtaacccatttgtaacc
cacagcgtgactcgtgaagtactgcttctgtctcgctggaaagcggcagacctatacctc
aatgacatcaacgaactgatcagcgaactgtcgatgacagtgtgcaacgacaaagttcgt
gagcttgccggtgatgatcagcacgaaccataccgtgcgatcctgaaacagcttcgttca
ctattgaacgaaacgaaagacattctagacgcgaaagttcatggccagaaactggcagtc
aaagcgccactgcaaaaagtagagcagctttgggaaccactttacgcgtgttaccaatca
ctaaatgaatgtggcatgggcgtaattgccaacggctcactgctggatacgctacgtcgt
gttaaagcgtttggtattcacctagttcgtctcgatatccgtcaagaaagtactcgtcat
gccgacgttctatctgaactgactcgttacctaggtattggtgactacgagcagtggagc
gagcaagataaggtagctttcctaaccaacgaacttgcatctaagcgccctcttctacct
cgtgactgggaaccatcagaaccagttaaagaggttttggatacctgtaagattgttgct
gcgcagcctcgtgaagcgtttggtgcttacgttatctcaatggcacgtaccgcttctgac
gtacttgccgtgcacctactgctgcaagaagcgggctgtccttaccgcatggacgtatgt
cctctgttcgaaaccctagacgatttgaacaacgcggaagcggtaatcaaacagctgatg
ggcatcgacctataccgcggctttatccaaaaccaccaaatggtgatgatcggctactct
gactctgcaaaagatgcgggcgtaatgtcagcaggctgggcgcaataccacgcgatggat
tcactggttaaggttgcagaagaagaaggcgtagaactcacactgttccacggtcgtggc
ggtacgattggtcgtggtggtgcgccagcacatgctgcactactatctcagccacctaag
agtttgaaaggtggtctgcgtgtaacagagcaaggcgaaatgatccgctttaagttgggt
ctacctgatgttgccgttaacagtttcaacctgtacgcaagtgcaatccttgaagctaac
ctactgccaccaccagagcctaaacaagagtggcgcgacctaatggacgtgttgtctgaa
gtgagctgtgaagcttaccgtagcgtcgttcgtggcgagccagacttcgtgccttacttc
cgccaagcaacacctgaacttgagctaggtaaactgcctctaggctctcgccctgcaaaa
cgtaatccaaacggtggcgtagaaagcttgcgtgcgattccatggatcttctcttggagc
caaaaccgcttggttctacctgcatggctaggtgctggtgaagcaattcaatactcggta
gacaaaggtcatcaggcgctactggaagaaatgtgtcgtgaatggccattcttctcaact
cgcctaggcatgcttgagatggtgtacaccaagtgcaacatggaaatctctcgttactat
gatcaacgcctagttgagacgccacttcagccattgggtgaccgactgcgtgaacagctt
caacgtgatattaagtccgtactgaacgtagagaacaacgagaacctaatgcaaagcgac
ccttggggccaagaatcaatccgcctacgtaacatctacgtagagccattgaacatgctt
caagcggagttgctataccgtactcgtcaaacagaagaagcttctgcaaatctagaagaa
gcattgatggtcacgattgctggtattgccgctggtatgcgtaacacaggttaa

DBGET integrated database retrieval system