KEGG   Vibrio owensii: A9237_18705Help
Entry
A9237_18705       CDS       T04844                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vow  Vibrio owensii
Pathway
vow00500  Starch and sucrose metabolism
vow01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vow00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A9237_18705
Enzymes [BR:vow01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A9237_18705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Cyc-maltodext_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AQW60072
LinkDB All DBs
Position
2:477487..478836
Genome map
AA seq 449 aa AA seqDB search
MSGLQETQSTGANVILHAFDWKYADIAQRAAEISELGYGSVLVSPPMKSAQDERWWQRYQ
PQDYRVIDNALGNTTDFKNMVEALDRVGVLVYADVVFNHMANEAHLRSDLQYPRQAVMDD
YQQNASKYQDLTLFGDLSEPLFDENDFVEAFGIKDWKDKWEVQNGRISGGPTDPGLPTLR
VCKHVIEQQRTYLKALKALGVKGFRIDAAKHMTLEHLKLVWTEDITQDVHIFGEIITDGG
ATEEEYELFLEPYLKETRLGAYDFPLFSTIFKAFSKKGSFKSLIDPYCFGQALSNRRAIT
FAITHDIPNNDVFLDLVMDEENEWLAYAYILGRDGGVPLIYTDLDTSGIKGVDGKPRWQN
AWKDARMAKMVAFHNLVHGEPMTVLEGNDDMLVLQRGEKGILVLNKSARAQSLQLTVNKA
LVDMMTGEQVPSGEEIKVAAKSAMLLVEN
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttacaggaaacacaatcaacaggtgcaaatgttatcttgcacgcttttgat
tggaagtatgctgacattgcccaacgcgcagcggagatcagcgagctaggttatggctcg
gtattggtttctccgccgatgaaaagcgcacaagacgaacgctggtggcagcgttaccaa
cctcaagattatcgtgttatcgacaatgcgctcggtaataccacagattttaaaaacatg
gttgaagcactcgaccgtgtaggtgtattggtttacgccgatgtcgtctttaatcacatg
gcgaacgaagcacacctgcgctcggatttacaatatccgcgccaagccgtgatggacgat
taccagcaaaatgcaagcaagtatcaagatctgactctattcggtgacttgtcagaaccg
ctatttgatgagaatgacttcgttgaagcttttggcatcaaagattggaaagacaagtgg
gaagttcaaaatggtcgaatctcgggcggtccaaccgatcctgggttgccgactttacgt
gtgtgcaagcatgttattgagcagcaacgtacttacctgaaagcgcttaaggctctgggc
gtgaaaggtttccgtattgatgccgcaaagcacatgacgctagaacacctaaagttggtt
tggaccgaagacattactcaagacgtccatatctttggtgaaatcatcacagatggtggc
gcgacagaagaagaatatgagctgttcctagaaccgtatttgaaagaaacacggttaggt
gcatacgattttccgttgttctcaaccatctttaaggcgttctcgaagaagggcagtttt
aagtctttgatcgacccgtactgttttggtcaggctttatctaaccgtcgagctattact
ttcgcgatcactcatgatattccaaacaatgatgtgttcctggatttggtcatggatgaa
gagaacgaatggctagcgtatgcctacattctgggacgcgatggcggtgttccgcttatc
tacacggatttggataccagtggtatcaagggcgtggatggcaaaccaagatggcagaat
gcgtggaaggacgcacgtatggcaaagatggtggcattccataatcttgttcatggtgag
ccaatgacggtactggaaggtaacgacgatatgttggtacttcagcgcggcgagaagggc
atcttggtactcaacaaatctgcgcgagcgcaatcactgcaactgacagtgaacaaggct
ctggttgatatgatgaccggagaacaagtgcctagcggtgaagagattaaagtggcggcg
aaatcagcaatgctgcttgtagaaaactaa

DBGET integrated database retrieval system