KEGG   Vibrio owensii: A9237_23985Help
Entry
A9237_23985       CDS       T04844                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
vow  Vibrio owensii
Pathway
vow00230  Purine metabolism
vow00250  Alanine, aspartate and glutamate metabolism
vow01100  Metabolic pathways
Module
vow_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:vow00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A9237_23985
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A9237_23985
Enzymes [BR:vow01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     A9237_23985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AQW61075
UniProt: A0A3G2QK81
LinkDB All DBs
Position
2:1670274..1671530
Genome map
AA seq 418 aa AA seqDB search
MSSIVVVGANWGDEGKGRIVDFLAEQASASIRFQGGNNAGHTVVNDLGTFKLHQLPSGVF
NPDCLAVLGPGMVISPASLSEEIAEVAEAGVKVNMCISDRATLCLPLHALEDTLEEQRLG
DKAYGSTRQGIAPAYGDRVMKKGILVGWLKQPEVLVERIKFWMDWKLPQLRALYPTFEFE
QTAEEMANWLLEVSAPWRDAICNVTLPLKELQAKDQTLLFEAQLGAGRDLVYGEYPWTTS
SNVVSMYAGIGSGLPALRPERVIAVAKAFSSSVGTGTLITAMEEQDAFRELAGEFGATTG
RPRDMGYFDAVATKNGVELQAATEIALTKVDCLTGLKDLKICVGYEGEHSENPIWPQTAA
LAPIYEKMESWSEDITGCRKFEELPVAAQKYVLRIEELMGVPVKMVSVGPGREQMIMR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctatcgttgttgtgggtgcaaactggggtgatgaaggcaaaggccgcatcgtt
gactttttggcagagcaagcttctgcaagcattcgtttccaaggtggtaacaacgcgggt
cacaccgtagttaacgacctaggtacgttcaagctgcaccagctaccaagtggcgttttc
aaccctgactgtttggcagttttaggtccgggtatggttatcagccctgcgtcgctgtct
gaggagattgcggaagtcgcggaagcgggcgttaaagtgaacatgtgcatctctgatcgc
gcaacactatgtctacctctacacgcactagaagatacgctagaagaacaacgcttaggc
gacaaagcatacggttcaactcgtcaaggtattgcacctgcatacggcgaccgtgtgatg
aaaaaaggcatcctagttggttggttgaaacaaccagaagttctagtagaacgcatcaag
ttctggatggactggaaacttccacaactacgtgcactttacccaacgttcgaattcgag
caaaccgctgaagaaatggcgaactggttgctagaagtgtctgcaccttggcgtgatgct
atctgcaacgtaacgctgccgctaaaagagctgcaagcaaaagaccaaactctactgttc
gaagcacagctaggtgcgggccgtgaccttgtttacggtgagtacccatggacaacatct
tcaaacgttgtgtctatgtacgcgggtatcggtagtggtcttcctgctctacgtccagag
cgcgttattgcagtagcaaaagcgttcagctcatcagtaggtactggtacgctaatcacg
gcaatggaagagcaagatgcattccgtgaactagcgggtgaattcggcgcaacaacaggt
cgtccacgtgacatgggttactttgatgcagtagcgactaagaacggcgttgagcttcaa
gcagcgactgaaatcgcactgaccaaagtagactgcctgactggtcttaaagatctaaaa
atctgtgttggttacgaaggcgagcacagcgaaaacccaatttggcctcaaacggctgca
ctagcaccaatctacgagaagatggaaagctggagcgaagacattactggttgtcgtaag
ttcgaagagctaccagttgcggcacaaaaatacgttctacgtattgaagaactaatgggt
gtaccagtgaaaatggtatcggttggtcctggtcgtgaacaaatgattatgcgctaa

DBGET integrated database retrieval system