KEGG   Vibrio parahaemolyticus RIMD 2210633: VP0030Help
Entry
VP0030            CDS       T00120                                 

Gene name
fadB
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00071  Fatty acid degradation
vpa00280  Valine, leucine and isoleucine degradation
vpa00281  Geraniol degradation
vpa00310  Lysine degradation
vpa00362  Benzoate degradation
vpa00380  Tryptophan metabolism
vpa00410  beta-Alanine metabolism
vpa00640  Propanoate metabolism
vpa00650  Butanoate metabolism
vpa00903  Limonene and pinene degradation
vpa00930  Caprolactam degradation
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01120  Microbial metabolism in diverse environments
vpa01130  Biosynthesis of antibiotics
vpa01200  Carbon metabolism
vpa01212  Fatty acid metabolism
Module
vpa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    VP0030 (fadB)
   00650 Butanoate metabolism
    VP0030 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VP0030 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VP0030 (fadB)
   00310 Lysine degradation
    VP0030 (fadB)
   00380 Tryptophan metabolism
    VP0030 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VP0030 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VP0030 (fadB)
   00281 Geraniol degradation
    VP0030 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VP0030 (fadB)
   00930 Caprolactam degradation
    VP0030 (fadB)
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VP0030 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VP0030 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VP0030 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VP0030 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1187486
NCBI-ProteinID: NP_796409
UniProt: Q87TN9
LinkDB All DBs
Position
I:complement(28083..30254)
Genome map
AA seq 723 aa AA seqDB search
MIYQADTLQVKEIQDGIAELSFCSPKSVNKLDLATLESLDKALDALTSHQGLKGLMLTSD
KDAFIVGADITEFLGLFAKTDAELDQWLQFANSIFNKLEDLPVPTISVLKGHTLGGGCEC
VLATDMRIGDKTTSIGLPETKLGIMPGFGGCVRLPRVIGADSAMEIITQGKACRADEALK
IGLLDAVVETDALYESALQTLTSAINEKIDWQARRKQKTSPLTLSKLESMMSFTMAKGLV
AQVAGPHYPAPMTAVITIEEGARFARNEALDIERKYFVKLAKSEEAKALVGLFLNDQYIK
GIAKKAAKSASKDTERAAVLGAGIMGGGIAYQSALKGVPVLMKDIAQPSLDLGMTEASKL
LNKRLAQGRIDGFKMAGILASITPSLHYAGIENSDVIVEAVVENPKVKATVLSEVESHVG
EDTVITSNTSTIPINLLAQSLKRPENFCGMHFFNPVHRMPLVEIIRGEKTSDETINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFGGFSMLLRDGADFTKVDKVMERKFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPERMGKQGRDAIDALFEANKYGQKNGNGFYSYTIDKKGK
PKKTFTEDILPVLADVCADKQEFDEQTIIQRMMIPMINEVVLCLQEGIIATPQEADMALV
YGLGFPPFRGGVFRYLDSVGIAEFVEMAKQHADLGAMYHVPQMLIDMAAKGESFYGAQQQ
GSI
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccgacaccctacaggtaaaggaaatacaagatggcatagcagagctg
agcttctgctcccctaaatccgtaaacaagctcgacctagcaacgctagagtctctcgat
aaggctcttgatgcgttgacttcacatcaaggtctaaagggcttaatgctcacttcagat
aaagatgcgttcatcgttggcgcagacatcactgaattcttgggcctcttcgctaaaaca
gacgccgagctcgatcaatggctacaatttgccaatagcatcttcaataaactagaagac
ttacccgttccgacaatctcagtacttaaaggtcacacacttggcggcggctgcgaatgc
gtactggctaccgacatgcgtatcggtgataaaaccaccagcattggcctaccagaaacc
aaacttggcatcatgcctggctttggcggttgtgtgcgtttgccgcgtgttatcggtgca
gatagcgcgatggaaatcatcacgcaaggcaaagcatgtcgtgcagatgaagcattgaag
attggtttattggatgctgtggttgaaactgatgcgttgtatgaatccgcattgcaaaca
ctgacttcagctatcaacgaaaagatcgattggcaagcacgtcgtaaacaaaaaacctcg
ccactgacactcagcaagctagagtcgatgatgagcttcacgatggcaaaaggcctagtg
gcacaagtagccggtccacactaccctgcgccaatgacagccgttatcacgattgaagaa
ggcgcacgctttgcgcgtaacgaagcactcgacattgaacgcaaatacttcgttaaactc
gcgaaatcagaagaagccaaagctctggttggtctgttcctcaacgaccaatacatcaaa
ggcatcgcgaaaaaagcggcgaaatcagcaagcaaagacactgagcgagcagcggtatta
ggtgcaggcatcatgggtggtggcatcgcttaccaatctgcgctgaaaggcgtgccagta
ttgatgaaagacatcgcccaaccatctctcgatttaggcatgaccgaagcgtctaaactg
ctgaacaaacgccttgctcaaggtcgtatcgacggcttcaagatggcgggaattttggca
tcaattaccccaagcctacattacgcaggcatcgaaaactcagatgtgattgttgaagcc
gttgtcgaaaatccaaaagtaaaagcaacggtactgagcgaagtcgaatcgcacgttggt
gaagacaccgtcattacatcaaacacatcgacgattccaatcaacctattggcacaatca
cttaaacgcccagaaaatttctgtggtatgcacttctttaaccctgtgcatcgcatgcct
ttggttgaaatcatccgtggtgagaaaacttctgatgaaaccatcaaccgcgtagtggct
tacgcagcgaaaatgggtaaatccccaatcgtcgtgaacgactgtccgggattcttcgtc
aaccgcgtattattcccgtactttggcggtttcagcatgttgcttcgtgacggtgcagac
ttcactaaagtcgacaaagtcatggaacgcaaatttggctggccgatgggcccggcgtac
ttgcttgatgtagtcggcatcgatactgcgcaccacgcacaagcggtgatggcagaaggt
ttccctgagcgaatgggtaaacaaggtcgtgacgcgattgatgctctattcgaagccaac
aaatacggtcagaagaatggcaacggtttctatagctacaccattgataaaaaaggtaag
cctaagaaaaccttcactgaagatatcttgccagtactggcagacgtctgcgcggataaa
caagagttcgatgagcagaccatcatccaacgtatgatgattccgatgatcaacgaagtg
gtgctgtgtctgcaagaaggcattattgcaacgcctcaagaagcagatatggcgctggtt
tacggccttggtttccctccattccgcggcggtgtattccgctacctagacagcgtaggt
attgctgaatttgttgaaatggcaaaacagcacgctgatctaggcgcgatgtaccatgtt
ccgcaaatgttgattgatatggcggcgaaaggcgaaagcttctacggcgcgcaacagcaa
ggttctatctaa

DBGET integrated database retrieval system