KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2118Help
Entry
VP2118            CDS       T00120                                 

Definition
(RefSeq) manganese superoxide dismutase Mn-SOD
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VP2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 1189630
NCBI-ProteinID: NP_798497
UniProt: Q87MW3
LinkDB All DBs
Position
I:2223415..2224014
Genome map
AA seq 199 aa AA seqDB search
MENRVMAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEE
IIKTSTGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDAA
INNFGSSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDY
MNGFWALVNWDFVAENLAK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggagaatcgagtaatggcatttgaactaccagctcttccttacgcgaaagacgcacta
gaaccacacatctcagcagagactctagactaccaccacggtaagcaccacaacacttac
gttgttaagcttaacggtcttatccctggtactgagttcgaaggcaaaactctagaagag
atcatcaagacttctactggtggcgtattcaacaacgcagcgcaaatctggaaccacacg
ttctactggcactgtcttgctccaaacgcgggcggcgaaccaactggcgcagttgcagac
gcaatcaacgcagcattcggttctttcgaagaattcaaagcgaagttcactgacgcagca
atcaacaacttcggttcttcatggacttggctagttaagaaagctgacggttctctagaa
atcgttaacacttctaacgcagcaacgccactaacagaagaaggtactactccacttcta
actgttgacctatgggaacacgcgtactacatcgattaccgcaacgtacgtcctgattac
atgaacggcttctgggctcttgtaaactgggacttcgtagctgagaacctagcgaagtaa

DBGET integrated database retrieval system