KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2751Help
Entry
VP2751            CDS       T00120                                 

Definition
(RefSeq) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00550  Peptidoglycan biosynthesis
vpa01100  Metabolic pathways
vpa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VP2751
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    VP2751
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:vpa01003]
    VP2751
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vpa01011]
    VP2751
Enzymes [BR:vpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     VP2751
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     VP2751
Glycosyltransferases [BR:vpa01003]
 Polysaccharide
  Bacterial polysaccharide
   VP2751
Peptidoglycan biosynthesis and degradation proteins [BR:vpa01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   VP2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-GeneID: 1190301
NCBI-ProteinID: NP_799130
UniProt: Q87L61
LinkDB All DBs
Position
I:2914647..2917217
Genome map
AA seq 856 aa AA seqDB search
MKFIKRLLFLTLICIILGVTTIFGFYQYVKPELPDVATLKDVELQTPMQVFSQDGKLIAQ
FGEKRRIPVTYDEIPQDLIHALIATEDSRFYEHPGIDPIGITRAAVVVALSGSAKQGAST
ITQQLARNFFLSNEKKLMRKIKEIFIAIHIEQLLSKQEIMELYVNKIFLGYRSYGFGAAA
QVYFGKSLNELSLSEIATLAGMPKAPSTMNPIYSLERATKRRNVVLMRMLDEKYITQEQF
DEARNEPIIARYHSAEIEVSAPYVAELARAWAVKEYGEEKAYTSGLNIYMTVDSKLQDAA
NKAAVNNLMAYDERHGYRGAEKVLWKEGEAAWDAEQIEKHLKGQPTYGDLYPAVVTKVEG
KTAQVVVKNNDAQTIPWTGINWARKFLTDNRQGSTPKSAQEVLAAGEQIWVRELTTTDED
GNTQSSWKLSQVPSANTAFVAMNPENGGILSLVGGFNFVHSKFNRATMSVRQVGSSIKPF
IYSAAIDKGLTLATLINDAPINKWDAGSGSAWRPKNSPPTYGGPTRLRIGLAQSKNVMAV
RTLREVGLDETRQYLTRFGFDINEVPRSETIALGAGSLTPMKVAQGYSVFANGGYYVEPF
YVERVEDAFGEVLFKANPKSVCHQDCPQMSPQPEMDRFASEFGEQDVAVDGQAPENALEN
DEPKYAPQVISEQNAFLMREMMYSNIWGGGNWREGTGWNGTGWRAQKLERRDIGGKTGTT
NDSKDAWYNGYGPGVVAIAWVGFDDHSRALGRTTVNSNLGQGQVSGAESGAKTAEPAWID
FMQVALEGKPEQGKNIPDDIVRVRIDRNSGLLTHKVDSTSMFEYFEKGTEPTEYVGNSLE
DSIYSSGSGGTTEELF
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcataaagcgtttattatttttaacattgatttgcataattcttggagtcacc
acaatttttggcttctatcagtacgtgaagcctgaattgccagacgttgcaactctaaaa
gacgttgaattacaaacacctatgcaggtatttagtcaagacgggaagctgatcgcacag
tttggtgaaaagcgtcgtattcctgttacttacgatgaaattcctcaagacctaattcac
gcactgatcgccaccgaagacagccgtttttacgagcaccctggtatcgatccaatcggt
attactcgtgcagctgtcgtggttgctctttccggctcagcaaagcaaggcgcgagtacc
atcactcagcagctagcgcgtaacttcttcttatccaacgagaagaaactaatgcgtaag
atcaaagagatcttcattgccattcacattgagcaactgctgagcaaacaagagatcatg
gagctttacgttaacaagatcttccttggctatcgctcatacggttttggtgcagcagct
caggtgtattttggtaagagcctaaatgagctctcgcttagcgaaattgcgacactggcg
gggatgccaaaagccccttcaaccatgaacccaatatactcgctagaacgtgcaacaaaa
cgtcgtaacgttgtgctaatgcgtatgctcgatgaaaagtacattacgcaagaacaattc
gatgaagcacgtaacgaaccaatcattgctcgttaccacagtgcagaaattgaagtgtct
gcgccttacgttgccgaacttgcacgtgcatgggcagtaaaagagtacggtgaagagaaa
gcctatacgtcgggtttgaatatctacatgacggttgactctaaactgcaagacgctgcc
aataaggctgcggtaaacaacctaatggcttatgacgagcgtcatggctaccgtggcgca
gaaaaagtgttgtggaaagaaggggaagccgcttgggatgcagaacaaattgagaagcat
ctaaaaggccagccaacttacggcgatctttaccctgctgtcgtgacaaaagtggaaggc
aaaacggcgcaagttgttgtgaaaaataacgacgcacaaaccatcccttggactggcata
aactgggcacgcaaattcctcaccgataaccgtcaaggttcaacaccaaaatctgcacaa
gaggttttagctgcaggtgaacaaatttgggttcgcgagctaacgaccaccgatgaagat
ggcaacactcaaagcagctggaagctaagccaagtgcctagcgcgaacaccgcatttgtc
gcgatgaatcctgaaaatggcggcattttgtcactggtaggtggttttaactttgttcac
agcaagtttaaccgcgcaaccatgtccgtgcgtcaggttggttctagtatcaaaccattt
atttactcagccgctatcgataaaggcctaacgttagcaactctgatcaacgacgcgcca
atcaacaaatgggacgcaggttcaggatcggcatggcgaccaaagaactcacctccaact
tacggtggtccaactcgccttcgcattggcttagcgcaatcgaaaaacgtaatggcggtt
cgtaccttacgtgaagtaggtctggatgaaactcgtcagtacctaactcgctttggattc
gatatcaacgaagtgcctcgctcagaaactatcgccttgggtgcgggtagcttaacgcca
atgaaagtggcgcaaggttactcggtttttgcaaacggcggttactatgttgagccgttc
tacgtagaacgtgttgaagatgcatttggcgaagttttgtttaaagccaaccctaagagc
gtttgtcatcaagattgcccacaaatgagcccacaaccagaaatggatcgctttgcaagt
gagttcggtgagcaagacgttgccgttgatggccaagctccagagaacgcactagaaaat
gatgaaccaaaatacgcaccacaagtgatctctgaacaaaacgcattcttgatgcgtgaa
atgatgtacagcaacatctggggtggcggcaattggcgtgaaggtactggttggaacggt
actggctggcgtgcgcaaaaacttgagcgtcgtgatattggtggtaaaactggtacgact
aacgattcaaaagacgcatggtacaacggttatggtccgggcgtagttgcgattgcatgg
gtgggcttcgatgatcactcacgcgcgttaggccgcacgacggtgaacagcaatttgggt
caaggccaagtatctggtgctgaatcaggagcgaaaacagcagagccagcatggattgac
tttatgcaagtagcattggaaggcaagccagaacaaggcaagaatattccagatgacatc
gtgcgcgttcgcatcgatcgcaacagcggtctgctgactcataaagtggatagcacgtcc
atgtttgaatactttgagaaaggcacggagccaaccgaatacgttggtaacagcctcgaa
gacagcatttattcaagcggttctggtggcacaacggaagagttgttctaa

DBGET integrated database retrieval system