KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2805Help
Entry
VP2805            CDS       T00120                                 

Definition
(RefSeq) phosphoglycolate phosphatase
  KO
K01091  phosphoglycolate phosphatase [EC:3.1.3.18]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00630  Glyoxylate and dicarboxylate metabolism
vpa01100  Metabolic pathways
vpa01110  Biosynthesis of secondary metabolites
vpa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VP2805
Enzymes [BR:vpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     VP2805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_3 S6PP Hydrolase_6 Put_Phosphatase Acid_phosphat_B Acid_PPase Glyoxalase_4
Motif
Other DBs
NCBI-GeneID: 1190355
NCBI-ProteinID: NP_799184
UniProt: Q87L12
LinkDB All DBs
Position
I:complement(2968653..2969339)
Genome map
AA seq 228 aa AA seqDB search
MTQQDIKLIAFDLDGTLLDSVPDLAVAADQAVQALGYPAVSEEQVRDYVGNGADVLIGRA
LSQSMTISSDLSEDLRAKGRELFDDFYAQSGHQLSHLYPTVKETLEELHQAGFTMALVTN
KPSKFVPEILEQHGIAKYFVDVLGGDAFPEKKPNPVALNWLMEKHQVKASEMLMVGDSKN
DILAAKNAGCASFGLTYGYNHGEPISASNPDFVADSLSELLEVVAVSA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaagatattaaactgattgcgttcgatctggatggcacattgttggacagc
gtacctgatttggccgttgctgcagaccaagcggtacaagctttgggttaccctgcggta
tcggaagagcaagtacgtgattacgtaggtaacggtgctgacgtcctgattggccgcgca
ctaagccaaagcatgaccatcagtagcgatcttagtgaagacctgcgtgcaaaaggacgc
gagctgtttgatgacttttacgcgcaaagcggtcatcagctgagccatctttacccaaca
gtaaaagagacgctagaagagctacatcaggcaggctttacgatggcgcttgtaacgaac
aaaccatcgaagtttgtgccagaaattctagagcaacatggcatcgcaaaatactttgtg
gacgtattgggtggtgatgcattccctgagaaaaaaccaaacccagtcgcactgaactgg
ttgatggaaaaacatcaggtgaaagcgagcgaaatgctgatggttggcgactcgaagaat
gacatccttgcggcgaaaaacgcaggttgtgcttcgtttggtttaacatacggttacaac
catggtgagcctatttcagcttcaaacccagattttgtcgcagacagtttatctgaatta
ttggaagtagtagccgtttctgcataa

DBGET integrated database retrieval system