KEGG   Vibrio parahaemolyticus RIMD 2210633: VP2848Help
Entry
VP2848            CDS       T00120                                 

Gene name
alr
Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Pathway
vpa00473  D-Alanine metabolism
vpa01100  Metabolic pathways
vpa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VP2848 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VP2848 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vpa01011]
    VP2848 (alr)
Enzymes [BR:vpa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VP2848 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:vpa01011]
 Precursor biosynthesis
  Racemase
   VP2848 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 1190411
NCBI-ProteinID: NP_799227
UniProt: Q87KX6
LinkDB All DBs
Position
I:3015397..3016575
Genome map
AA seq 392 aa AA seqDB search
MGQTAAHAAPLLVDFDDSEREERVQASNAWLEIDTQAFSNNIQLLQKDLKGNTQICAIMK
ADAYGNGIAGLMPSIIANNVACVGITSNEEARVVREHGFEGKIMRVRAASRNEIENGVQY
EIEELIGTKMQADQIIEIAYNYNTVIPVHLALNTSGMGRNGLDLTTYEGQVEGVEIASDP
NLKIVGMMTHFPNEGLDEIRRKVDRFKVETKWLMDSAGLKRKDITLHVANSYITLNLPEA
HLDMVRPGGMLYGDYPATLPYERIVSFKTRIASLHFFPAGSTIGYGSTKVLERDSILANL
PIGYSDGFARSLSNKADVLINGQRARVMGKASMNTTMVDVTDIIGVQANDEVVVFGRQGF
EEITAEETEEKSGRILPEHYTIWGATNPRVYR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggccaaacagccgcacatgccgctcctctgctagttgattttgatgacagcgagcgc
gaagagcgcgttcaggcgagcaacgcttggctggaaattgatactcaggcattttcaaat
aatattcagttgcttcagaaggatctaaagggcaacactcagatctgtgccatcatgaag
gctgacgcgtacggtaacggtatcgcaggcctgatgcctagcatcatcgcgaacaacgtt
gcatgtgtgggtatcaccagtaatgaagaagctcgcgtagtgcgtgagcatggcttcgaa
ggcaagatcatgcgtgtccgtgcggctagccgcaacgaaattgaaaacggcgtacagtac
gaaatcgaagagctgattggcactaaaatgcaggcggatcaaatcatcgagattgcatac
aactacaataccgttattcctgttcaccttgctctgaatacttcaggcatgggtcgtaat
ggtctggatctgacaacgtatgaaggtcaggttgaaggtgtggaaatcgcaagcgatcct
aacctaaaaatcgtaggtatgatgacccacttcccgaatgaaggtcttgatgaaatccgc
cgcaaggttgaccgtttcaaagtagaaacaaagtggctaatggacagcgcaggtctgaaa
cgtaaagacatcacactgcacgtggctaactcttacatcacgctaaatctgcctgaagca
catctggatatggttcgtcctggcggcatgctgtacggtgactaccctgcaaccctacct
tacgagcgcatcgtgtctttcaaaacacgcatagcatcactgcacttcttccctgcaggc
agcacaatcggctacggcagcactaaagttttagagcgtgactctatcctggctaaccta
cctatcggctactcagacggtttcgcccgttcactaagcaacaaagctgatgttctgatc
aacggtcagcgtgctcgcgtaatgggtaaagcgtcaatgaacactactatggttgatgtc
actgacatcattggtgtccaggcaaacgacgaagtagttgtatttggccgccaaggcttt
gaagaaatcacagcagaagaaaccgaagagaaaagcggtcgtattctgcctgagcactac
actatctggggtgcaactaaccctcgcgtttaccgttaa

DBGET integrated database retrieval system