KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1514Help
Entry
VPA1514           CDS       T00120                                 

Definition
(RefSeq) superoxide dismutase, Cu-Zn
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VPA1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu GP88
Motif
Other DBs
NCBI-GeneID: 1192210
NCBI-ProteinID: NP_801024
UniProt: Q87G06
LinkDB All DBs
Position
II:1620670..1621185
Genome map
AA seq 171 aa AA seqDB search
MLKGLLCISAAAAFVMTPNALAQSITMTDLGTNQAVGTVDLSESDYGIVFTPNLSGIPAG
LHGFHVHANPSCDSAEKDGKTVVGGGAGGHYDPDNTGQHGFPWTDGNHLGDLPALYADME
GNANQPVLAPRLKMSDLKGRALMIHAGGDNHSDQPAKLGGGGARIVCGVID
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggattgctgtgcatctcagcggcggctgctttcgtgatgacaccaaacgcg
ttggcccaatcaatcaccatgaccgatttgggtactaaccaagccgtcggtacggtggac
ttatcagagagtgactacggaattgtattcacgccgaatctgtcaggaattcctgccgga
ctacatggctttcacgtccacgctaacccatcctgtgacagtgcagaaaaggacggtaaa
accgtagtaggtggcggtgcgggcggccattacgacccagacaatactggccaacatggt
tttccatggaccgatggcaaccatcttggcgatctgccagcgttgtacgccgacatggaa
ggaaacgccaaccaaccggttttagctccgcgcctcaaaatgtcggatttaaaaggcaga
gccttgatgattcatgctggcggtgataatcactcggatcaaccagccaaattaggtggc
ggcggtgcacgcattgtgtgtggcgtgatcgactaa

DBGET integrated database retrieval system