KEGG   Vibrio parahaemolyticus RIMD 2210633: VPA1684Help
Entry
VPA1684           CDS       T00120                                 

Definition
(RefSeq) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vpa  Vibrio parahaemolyticus RIMD 2210633
Brite
KEGG Orthology (KO) [BR:vpa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VPA1684
Enzymes [BR:vpa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VPA1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like Thi4 FAD_binding_3 Thioredoxin_9 DAO Chalcone_N NAD_binding_8 DUF5474 Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 1192380
NCBI-ProteinID: NP_801194
UniProt: Q87FJ5
LinkDB All DBs
Position
II:1804339..1805907
Genome map
AA seq 522 aa AA seqDB search
MLDQAIQQQLKQYLANVKEDVRLVVSLDESKASNDILSLANQIAEMSDFITVERDDNASA
RKPVMTVTNPVKGTALRFAGLPMGHEFTSLVLALLHSGGHPIKLEPEVIEQIAALDKELD
VEVFISLSCQNCPDVVQAFNMMAAINPKVKATMIDGALFQDEVKQRDIMAVPSVFVNGEL
FGQGRMSLTEILNKVDDGASEKAAKALSEKAPYDVLVVGGGPGGSAAALYAARKGIRTGV
VAKRFGGQVMDTMAIENFISVKRTEGPKLATDLAEHLKEYDVDVVTEQQAQKLMGAAHTD
DGLIHIQLESGATLKSKSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADVLRADQVLIDKANSLPNIDIITMAQTTEVVG
DGTRVTSLKYKDRNTDEIKEIELSGIFVQIGLVPNTEWLKDSEVALSERGEIEVGSRGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaagcgatccaacaacaactcaaacaatatctggctaatgtaaaagaagac
gttcgtctagtggttagtctagatgaaagcaaagcatcgaatgacattctgtctctggcg
aaccaaatcgcagagatgagcgactttatcaccgttgaacgtgacgacaacgcaagcgca
cgtaaaccggtgatgacggttacgaacccagtaaaaggcacagcacttcgctttgctggc
ctaccaatgggtcacgaatttacctctctggtattggcattactgcactctggtggtcac
ccaatcaaactagagccggaagttattgaacaaatcgcagcgctagataaagaattggat
gttgaagtgttcatttcactctcgtgccaaaactgcccagacgttgttcaagcgttcaac
atgatggcggcgatcaacccgaaagtgaaagcaaccatgatcgacggtgcactcttccaa
gatgaagtaaaacaacgtgacatcatggcagtaccaagcgtattcgtgaacggtgagcta
ttcggtcaaggtcgtatgtctctgactgaaatcctaaacaaagtggatgacggcgcgagc
gagaaagcagccaaagcactgagcgaaaaagccccatacgacgtgctagttgtcggcggt
ggccctggtggtagtgcagcagcactatacgcagcgcgtaaaggtattcgcactggtgtt
gtcgctaaacgcttcggtggtcaggtgatggacaccatggcaatcgagaactttatctcg
gtaaaacgtactgaaggtccaaaactggcgactgacctagcagagcacctaaaagaatat
gacgtagacgtcgtgactgagcaacaagcgcaaaaactgatgggcgcagcacacacagat
gatggcttgattcatatccaacttgaaagcggcgcaacgctgaaaagtaagagtgtcatc
ctaagccctggagctcgctggcgtgaaatgaacgttccgggtgagcaagagtaccgcaac
aaaggcgtcgcgtactgcccacactgtgacggcccgctattcaaaggcaagaaaaccgcg
gttatcggtggtggtaactcaggcatcgaagcggctatcgacctagcaggtattgttgag
cacgtaaccgttcttgaatttgcagacgtacttcgcgcagaccaagtgcttatcgacaaa
gcgaactctctaccaaacatcgacatcatcacgatggcgcaaaccacagaagtagtgggt
gacggtactcgcgtaacaagcttgaagtacaaagaccgtaacacagatgaaatcaaagag
attgaactgtcaggtatctttgtccaaatcggtctagtaccaaacacagaatggctaaaa
gattcagaagtagcgctttctgagcgcggcgaaattgaagttggtagccgtggtgaaacc
agcctggaaggtgtcttcgcagcgggtgacgcaacgacggttccttacaaacagatcatc
attgcgatgggtgaaggtgcaaaagcaagcttaggcgcgtttgactacctaatccgtaag
caaggttaa

DBGET integrated database retrieval system