KEGG   Vibrio parahaemolyticus BB22OP: VPBB_0803Help
Entry
VPBB_0803         CDS       T02409                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00020  Citrate cycle (TCA cycle)
vpb00190  Oxidative phosphorylation
vpb00650  Butanoate metabolism
vpb01100  Metabolic pathways
vpb01110  Biosynthesis of secondary metabolites
vpb01120  Microbial metabolism in diverse environments
vpb01130  Biosynthesis of antibiotics
vpb01200  Carbon metabolism
Module
vpb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpb_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VPBB_0803
   00650 Butanoate metabolism
    VPBB_0803
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VPBB_0803
Enzymes [BR:vpb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VPBB_0803
    1.3.5.4  fumarate reductase (quinol)
     VPBB_0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_4 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AGB09308
LinkDB All DBs
Position
1:874080..874790
Genome map
AA seq 236 aa AA seqDB search
MKLNFSLYRYNPDVDTKPYMKEYTLEVDEGSDMMVLDALILLKEQDPSIAFRRSCREGVC
GSDGLNMNGKNGLACITPLSALQGDKIVIRPLPGLPVVRDLIVDMTQFYDNYAKVKPFLI
DDGALPPSRENLQSPDERAHLDGLYECIMCACCTTSCPSFWWNPDKFIGPAGLLAAYRWL
IDSRDTATDERLSDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLVNRSV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaacttctctttgtaccgttacaacccggacgtagatactaagccttacatg
aaagagtacacacttgaggtagacgaaggctcagacatgatggtgcttgatgcattgatt
ctgctaaaagagcaagatccaagcatcgcattccgtcgttcttgtcgtgaaggtgtgtgt
ggttctgatggtttgaacatgaacggcaaaaatggtctggcatgtatcactccattatcg
gccctacaaggtgacaagatcgtcattcgtcctctaccgggtctacctgtagtgcgcgat
cttatcgttgacatgacgcagttctatgataactatgcaaaagttaagcctttcttaatt
gatgacggtgctctaccgccatcacgcgagaacctgcaatctccagatgagcgtgcgcat
ttagatggattgtacgaatgtatcatgtgtgcatgttgtacaacttcttgtccgtcattc
tggtggaacccagataagtttattggccctgcaggcctacttgcggcttaccgttggttg
attgatagccgagatacggcaacagatgaacgtttgtctgatcttgatgatgcatttagc
gtttttcgttgccatggcatcatgaattgtgtaagtgtttgtcctaagggactaaatccg
acgaaagccatcggtcacattaagtcgatgctggtgaatcgctcggtttaa

DBGET integrated database retrieval system