KEGG   Vibrio parahaemolyticus BB22OP: VPBB_1160Help
Entry
VPBB_1160         CDS       T02409                                 

Definition
(GenBank) Glutamate decarboxylase, eukaryotic type
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00250  Alanine, aspartate and glutamate metabolism
vpb00410  beta-Alanine metabolism
vpb00430  Taurine and hypotaurine metabolism
vpb00650  Butanoate metabolism
vpb01100  Metabolic pathways
vpb01110  Biosynthesis of secondary metabolites
vpb01120  Microbial metabolism in diverse environments
vpb02024  Quorum sensing
Module
vpb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VPBB_1160
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VPBB_1160
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VPBB_1160
   00430 Taurine and hypotaurine metabolism
    VPBB_1160
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VPBB_1160
Enzymes [BR:vpb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VPBB_1160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2 HSCB_C AAA_33
Motif
Other DBs
NCBI-ProteinID: AGB09654
LinkDB All DBs
Position
1:complement(1285233..1286879)
Genome map
AA seq 548 aa AA seqDB search
MVKEQKTADVSFESLLKIFTVPEGPDSTLTKIDESLSRNLNQFLREHIVAEEKPLREIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQNDKFYRKWMHSANHSLGAFCSGGTIANITA
LWVARNKALKADGDFKGVEKEGLFKAMKHYGYEGLAVLVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIVVDDLKAKIAELKEQNIKPIAVIGVAGTTETGNVDPLSQIAQVCQEHN
CHFHVDAAWGGATLMSNHYRHLLEGVELADSVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIEKARYFADL
IKQQDDFELVSEPELCLLTYRYLPPLIREALDKAEGTQKEKLNELINQLTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTRDILSSVLDEQREIAKQAPSLTAKIEE
MASDILGA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggaacaaaaaaccgctgacgttagctttgagagcttgctaaagatcttcacc
gtacctgaaggtcctgattctacgttgacaaaaattgacgaaagtctctcccgaaacttg
aaccaatttcttcgtgaacacatcgtggcagaagaaaagcctttacgtgaaatcgagaaa
gacttttcttctgctcagattcctgagcaacctgaattcgtgtcagatcacaccgagcac
ctgctagacacgttagtgtcgcactcggttcacacttcagccccaagttttatcggtcac
atgacctcggcgctaccctacttcttgatgcctttatccaagatcatgatcgcgctaaac
caaaacttggttaagatcgaaacatcaaaagcattcacacctcttgaacgtcaagtttta
gggatgttacaccgcttaatttacggtcaaaacgacaagttttatcgtaaatggatgcac
agcgcgaaccattcacttggtgcgttttgctctggtggcacaatcgcgaacattacggcg
ctttgggttgcacgcaataaagcgttgaaagcagatggtgatttcaaaggggtagaaaaa
gaaggtctattcaaagccatgaagcactatggctacgaaggccttgcagttctggtttct
gaacgtggtcactattcactgaaaaaagcagcagacgtacttggcttaggtcaagagggt
ttagtcgcggtgaaaaccgatgcaaacaaccgtattgttgttgacgacctaaaagcaaaa
attgccgagcttaaagaacaaaacatcaaaccaattgcggttatcggtgtcgctggcaca
acagaaacggggaacgtcgatcctctgtcgcagatcgctcaagtgtgccaagagcacaat
tgtcacttccatgtggatgccgcttggggaggtgcaacgttgatgtctaatcattaccgt
caccttctcgaaggtgttgaactggctgactcagtaactatcgacgcgcacaaacaactg
tacatccctatgggtgcaggcatggtgttgttcaaagacccagacgcgatgaaatccatt
gaacaccatgcgcaatacatcttacgtaaaggttcaaaagatttaggtagtcatacacta
gaaggctctcgctcaggcatggccatgttagtgtatgcggcgatgcacattattagtcgc
ccaggctacgaactattgatcgaccaaagtatcgagaaagcgcgctactttgccgatctc
atcaaacagcaagatgacttcgaactcgtttctgaaccggagctttgtctactgacatac
cgctatctaccgccattgattcgtgaagcgctagataaagcggaaggtactcaaaaggaa
aaactaaacgagctcatcaaccagctcacgcagtttatccagaagcgtcaacgtgaaacg
ggcaaatcgtttgtttctcgtacaaggctgaaccctgaccaatggcaaagaatgaacacc
atcgtattccgagtggtgcttgccaacccattgacgaccagagatatcttgagctcagta
ctggacgaacaacgcgaaatcgccaaacaagcaccaagtttgaccgcaaaaatcgaagaa
atggcctcagatattttaggcgcgtaa

DBGET integrated database retrieval system