KEGG   Vibrio parahaemolyticus BB22OP: VPBB_1953Help
Entry
VPBB_1953         CDS       T02409                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Brite
Enzymes [BR:vpb01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VPBB_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGB10423
LinkDB All DBs
Position
1:2177186..2177770
Genome map
AA seq 194 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLDYHHGKHHNTYVVKLNGLIPGTEFEGKTLEEIIKTS
TGGVFNNAAQIWNHTFYWHCLAPNAGGEPTGAVADAINAAFGSFEEFKAKFTDAAINNFG
SSWTWLVKKADGSLEIVNTSNAATPLTEEGTTPLLTVDLWEHAYYIDYRNVRPDYMNGFW
ALVNWDFVAENLAK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccagctcttccttacgcgaaagacgcactagaaccacacatctca
gcagagactctagactaccaccacggtaagcaccacaacacttacgttgttaagcttaac
ggtcttatccctggtactgagttcgaaggcaaaactctagaagagatcatcaagacttct
actggtggcgtattcaacaacgcagcgcaaatctggaaccacacgttctactggcactgt
cttgctccaaacgcgggcggcgaaccaactggcgcagttgcagacgcaatcaacgcagca
ttcggttctttcgaagaattcaaagcgaagttcactgacgcagcaatcaacaacttcggt
tcttcatggacttggctagttaagaaagctgacggttctctagaaatcgttaacacttct
aacgcagcaacgccactaacagaagaaggtactactccacttctaactgttgacctatgg
gaacacgcgtactacatcgattaccgcaacgtacgtcctgattacatgaacggcttctgg
gctcttgtaaactgggacttcgtagctgagaacctagcgaagtaa

DBGET integrated database retrieval system