KEGG   Vibrio parahaemolyticus BB22OP: VPBB_2698Help
Entry
VPBB_2698         CDS       T02409                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00473  D-Alanine metabolism
vpb01100  Metabolic pathways
vpb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VPBB_2698
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VPBB_2698
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vpb01011]
    VPBB_2698
Enzymes [BR:vpb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     VPBB_2698
Peptidoglycan biosynthesis and degradation proteins [BR:vpb01011]
 Precursor biosynthesis
  Racemase
   VPBB_2698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGB11150
LinkDB All DBs
Position
1:3014234..3015448
Genome map
AA seq 404 aa AA seqDB search
MKLKLSLTALALMGQTAAHAAPLLVDFDDSEREERVQASNAWLEIDTQAFSNNIQLLQKD
LKGNTQICAIMKADAYGNGIAGLMPSIIANNVACVGITSNEEARVVREHGFEGKIMRVRA
ASRNEIENGVQYEIEELIGTKMQADQIIEIAYNYNTVIPVHLALNTSGMGRNGLDLTTYE
GQVEGVEIASDPNLKIVGMMTHFPNEGLDEIRRKVDRFKVETKWLMDSAGLKRKDITLHV
ANSYITLNLPEAHLDMVRPGGMLYGDYPATLPYERIVSFKTRVASLHFFPAGSTIGYGST
KVLERDSILANLPIGYSDGFARSLSNKADVLINGQRARVMGKASMNTTMVDVTDIIGVQA
NDEVVVFGRQGFEEITAEETEEKSGRILPEHYTIWGATNPRVYR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgaaacttagcctaactgcactggctctaatgggccaaacagccgcacatgcc
gctcctctgctagttgattttgatgacagcgagcgcgaagagcgcgttcaggcgagcaac
gcttggctggaaattgacactcaggcattttcaaataatattcagttgcttcagaaggat
ctaaagggcaacactcagatctgtgccatcatgaaggctgacgcgtacggtaacggtatc
gcaggcctgatgcctagcatcatcgcgaacaacgttgcatgtgtgggtatcaccagtaat
gaagaagctcgcgtagtgcgtgagcacggcttcgaaggcaagatcatgcgtgtccgtgcg
gctagccgcaacgaaattgaaaacggcgtacagtacgaaatcgaagagctgattggcact
aagatgcaggcagatcaaatcatcgaaattgcatacaactacaataccgttattcctgtt
caccttgctctgaatacttcaggcatgggtcgtaatggtctggatctgacaacgtatgaa
ggtcaggttgagggtgtggaaatcgcaagcgatcctaacctaaaaatcgtaggtatgatg
acccacttcccgaatgaaggtcttgatgaaatccgccgcaaggttgaccgtttcaaagta
gaaacaaagtggctaatggacagcgcaggtctgaaacgtaaagacatcacactgcacgtg
gctaactcttacatcacgctaaatctgcctgaagcacatctggatatggttcgtcctggc
ggcatgctgtacggtgactaccctgcaaccctaccttacgagcgtatcgtgtctttcaaa
acacgcgtagcatcactgcacttcttccctgcaggcagcacaatcggctacggcagcact
aaagttttagagcgtgactctatcctggctaacctgcctatcggctactcagacggtttc
gcccgttcactaagcaacaaagctgacgttctgatcaacggtcagcgtgctcgcgtaatg
ggtaaagcgtcaatgaacactactatggttgatgtcactgacatcattggtgttcaggca
aacgacgaagtagttgtatttggccgccaaggctttgaagaaatcacagcagaagaaacc
gaagagaaaagcggtcgtattctgcctgagcactacactatctggggtgcaactaaccct
cgcgtttaccgttaa

DBGET integrated database retrieval system