KEGG   Vibrio parahaemolyticus BB22OP: VPBB_A0417Help
Entry
VPBB_A0417        CDS       T02409                                 

Definition
(GenBank) Glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
vpb  Vibrio parahaemolyticus BB22OP
Pathway
vpb00500  Starch and sucrose metabolism
vpb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VPBB_A0417
Enzymes [BR:vpb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     VPBB_A0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AGB11791
LinkDB All DBs
Position
2:444180..445529
Genome map
AA seq 449 aa AA seqDB search
MSGLQETQSAGANVILHAFDWKYADIAQRANEIHELGYGSVLVSPPMKSAHDERWWQRYQ
PQDYRVIDNALGDTQDFIYMVRELERVGVLVYADVVFNHMANEAHLRRDLQYPRQDVLDQ
YRQDEQKYLPLKLFGDLSKPLFSEEDFVEAFGIKDWKDKWQVQNGRITGGPTDPGLPTLR
VCEHVVEQQRAYLKALKAIGVKGFRIDAAKHMTLEHLKRVWTDDITQDVHIFGEIITDGG
ATEEEYQLFLEPYLQETRLGAYDFPLFSTIFKAFSKKGSFKSLIDPYCFGQALSNGRAIT
FVVTHDIPNNDVFLDLIMDEEDEWIAYAYILGRDGGVPLVYTDLDTSGIKNKNGKPRWKD
AWNDPRMAKMIAFHNVTHGESMTVLEGNDDMLVLKRGEKGIVVLNKSTRAQSLSLKTECD
WFDLMSDQSVKAGIELKVPAKSFMLLVQK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcttacaggaaacgcaatcagctggtgcaaacgtgattttgcacgcctttgat
tggaagtacgctgacattgcccaacgagcaaatgaaatccacgagctaggttatggttcg
gtgctggtttcgccaccaatgaaaagcgcccacgatgaacgttggtggcagcgctatcaa
ccacaagattaccgtgttatcgacaacgcgctcggtgacacccaagacttcatctacatg
gttcgcgagctcgaacgcgtaggcgttttggtgtacgccgatgtggtgtttaaccacatg
gctaacgaagcacatttacgccgtgatctgcaatatcctcgtcaggacgtgttagatcaa
taccgacaagatgaacagaaatacctgcctctaaagcttttcggcgatttatccaaaccg
ctatttagcgaagaagattttgttgaagcgtttggtatcaaagactggaaagataaatgg
caggtccaaaatggccgaattacaggtgggccaaccgatcctggtttaccaacccttcgc
gtttgtgaacatgttgtcgagcagcagcgagcttacttaaaagcattgaaagcgataggt
gtgaaaggcttccgtattgatgccgcgaagcacatgacgcttgaacacttaaaacgcgta
tggacagacgacataacccaagacgtgcatatttttggggaaatcattaccgatggcggt
gcaacagaagaagagtatcaactgtttcttgagccgtatttacaagaaacccgtttaggt
gcgtatgatttcccgctgttttcgaccatctttaaagcattttcaaaaaaaggcagtttc
aagtctctgattgacccttactgttttggccaagcgctttcaaacggtcgagccatcact
tttgtggtgacgcatgatattcccaacaacgacgtctttctcgatttgataatggatgaa
gaggatgagtggatcgcttatgcctacattcttggtcgcgatggcggcgtgcctttggtt
tataccgatttggataccagcggcattaagaacaaaaacggaaagccaagatggaaagac
gcttggaatgatcctcgtatggcgaagatgatcgcgtttcataatgtgactcatggcgaa
tcaatgacggtactggaagggaatgatgatatgctagtgctaaaacgcggagagaaaggc
attgtagtgctaaacaaatccacgcgcgcacaatcgctatcgctaaagactgagtgtgat
tggttcgatttgatgtcagatcaaagcgttaaagccgggatagaactgaaggttccggca
aagtcgttcatgttattggtgcaaaaataa

DBGET integrated database retrieval system