KEGG   Variovorax paradoxus B4: VAPA_1c09740Help
Entry
VAPA_1c09740      CDS       T02835                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00473  D-Alanine metabolism
vpd00550  Peptidoglycan biosynthesis
vpd01100  Metabolic pathways
vpd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VAPA_1c09740 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VAPA_1c09740 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    VAPA_1c09740 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:vpd01011]
    VAPA_1c09740 (ddl)
Enzymes [BR:vpd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VAPA_1c09740 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:vpd01011]
 Precursor biosynthesis
  Amino acid ligase
   VAPA_1c09740 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST ATP-grasp GARS_A CPSase_L_D2 TTL
Motif
Other DBs
NCBI-ProteinID: AGU48094
UniProt: T1X717
LinkDB All DBs
Position
1:1076108..1077079
Genome map
AA seq 323 aa AA seqDB search
MSLQDPKQFGKVAVLFGGSSAEREISLLSGNGVLEALRSRGVDAHAFDPAERDLVELRRE
GFARCFIALHGRHGEDGTVQGALELLGIPYTGSGVMASSVAMDKVMTKRIWQADGLPTPK
YVRLAFDQQSREQIRAVPDVLGLPLIVKPPREGSSIGVTKVEGYSQMQDAVALSAKYDAD
VLCEEFIEGEEVTCAVLGSGLDAHALPVVRIAAPEGAYDYQNKYFTDDVKYHCPSGLPEA
EEHEIQRITLAAYHTLGCRGWGRADVMIRASDRKPFLLEMNTSPGMTSHSLVPMSARAAG
IAYEDLCLRVLASASLDAAGGAQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgagccttcaggatccaaagcaattcggcaaggttgccgtgctgttcggcggaagctcc
gccgagcgcgaaatctcgctgctgtccggcaacggcgtgctcgaggcgctgcgctcgcgc
ggcgtcgatgcgcatgccttcgatcccgccgagcgcgacctggtcgagttgcggcgcgag
gggttcgcgcgctgcttcatcgcgctgcacggccggcatggcgaggacggcacggtgcag
ggcgcgctcgaactgctcggcattccctacaccggctcgggcgtgatggcttcgagcgtg
gccatggacaaggtcatgaccaagcgcatctggcaggccgatggactgccgacgcccaag
tacgtgcgcctggctttcgaccagcaaagccgcgagcagatccgcgccgtgcccgacgtg
ctcggcttgccgctgatcgtgaagccgccgcgcgagggctcgtcgatcggcgtgaccaag
gtcgagggctattcgcagatgcaggacgcggtggcgctttcggcgaagtacgacgccgac
gtgctgtgcgaggaattcatcgaaggcgaggaagtgacctgcgccgtgctcggcagcggc
ctcgacgcgcatgcgctgccggtggtgcgcattgccgcacccgaaggcgcctacgactac
cagaacaagtacttcaccgacgacgtgaagtaccactgcccgagcggcctgcccgaagcc
gaggagcacgagatccagcgcatcacgctggccgcgtaccacacgctcggctgccgcggc
tggggccgcgccgacgtgatgatccgcgcgagcgaccgcaagcctttcctgctcgagatg
aacacttcgcccggcatgaccagccattcgctggtgcccatgtcggcgcgcgcggcgggc
attgcctacgaagacctgtgcctgcgcgtgctggcctcggcttcgctggatgccgcgggg
ggagcgcaatag

DBGET integrated database retrieval system