KEGG   Variovorax paradoxus B4: VAPA_1c12040Help
Entry
VAPA_1c12040      CDS       T02835                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase AroK
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01130  Biosynthesis of antibiotics
vpd01230  Biosynthesis of amino acids
Module
vpd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAPA_1c12040 (aroK)
Enzymes [BR:vpd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     VAPA_1c12040 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA_17 Cytidylate_kin2 AAA_22 Cytidylate_kin AAA_16 CoaE
Motif
Other DBs
NCBI-ProteinID: AGU48320
UniProt: T1X826
LinkDB All DBs
Position
1:1327257..1327805
Genome map
AA seq 182 aa AA seqDB search
MAVALVGLPGAGKSAVGRRLGARLDLPFVDTDHVIEQRIGCSIRDYFEREGEVAFRDLEQ
AVIADLAAQPHGVLATGGGAVLREANRKQLRDHFHVIYLRSSPEDLFRRLRHDVKRPLLQ
VADPLGRLRELHDARDPLYRETAHEVVDTGRPSIAMLVDIIVMQLELAGIVAPGAQPEEP
SD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtcgcactcgtcgggttgcccggcgccggcaagtccgcagtgggccggcgcttg
ggcgcgcgcctggaccttcccttcgtcgataccgatcacgtgatcgagcagcgcatcggc
tgctcgatccgcgattatttcgaacgggagggcgaagtcgccttccgggacctcgagcag
gccgtcatcgccgaccttgccgcccagccccacggcgtgctggccacggggggcggcgcc
gtcctgcgggaagccaaccgcaagcagctgcgggaccacttccacgtgatctacctgcgc
tcctcgcccgaagacctgttccggcgcctgcgccacgatgtcaagcggcccctgttgcag
gtggccgacccgctgggccggctgcgcgaactgcacgatgcgcgcgatccgctctaccgc
gagacggcccacgaggtggtggacaccgggcgtccctcgatcgccatgctggtggacatc
atcgtgatgcagctggaactcgccggaatcgtggctccgggcgcccagccggaagagccc
tccgactga

DBGET integrated database retrieval system