KEGG   Variovorax paradoxus B4: VAPA_1c15200Help
Entry
VAPA_1c15200      CDS       T02835                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, iron-sulfur subunit SdhB
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00020  Citrate cycle (TCA cycle)
vpd00190  Oxidative phosphorylation
vpd00650  Butanoate metabolism
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01120  Microbial metabolism in diverse environments
vpd01130  Biosynthesis of antibiotics
vpd01200  Carbon metabolism
Module
vpd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAPA_1c15200 (sdhB)
   00650 Butanoate metabolism
    VAPA_1c15200 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VAPA_1c15200 (sdhB)
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VAPA_1c15200 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     VAPA_1c15200 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4_16 Fer4 Fer4_4 Fer2 Ric8
Motif
Other DBs
NCBI-ProteinID: AGU48632
UniProt: T1X6U9
LinkDB All DBs
Position
1:complement(1656217..1656918)
Genome map
AA seq 233 aa AA seqDB search
MKRTFQIYRYDPDKDAKPYMQTVEIELDGHERMLLDALMKLKAQDPTLSFRRSCREGVCG
SDAMNINGKNGLACLTNMLTLKGTIVLKPLPGLPVIRDLIVDMTQFFKQYNSIKPYLQND
NVPPEKERLQSPEERDELNGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDEATAERLDNLEDPYRLFRCHTIMNCVDVCPKNLNPTKAIGKIKELMVRRAI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcacattccagatctaccgctacgacccggacaaggacgccaagccctacatg
cagaccgtcgagatcgaactcgacggccatgagcgcatgctgctcgacgccctgatgaag
ctcaaggcgcaggatcccaccctgtcgttccgccgctcgtgccgcgaaggcgtctgcggc
tccgacgcgatgaacatcaacggcaagaacggcctcgcctgcctgaccaacatgctcacg
ctcaagggcacgatcgtgctgaagccgctgccgggcctgcccgtcatccgcgacctgatc
gtggacatgacgcagttcttcaagcagtacaactcgatcaagccgtacctgcagaacgac
aacgtgccgcccgagaaggagcgcctgcagtcgcccgaggagcgcgacgagctcaacggc
ctgtacgagtgcatcctgtgcgcgagctgctcgaccagctgtccgagcttctggtggaat
cccgacaagttcgtgggcccggccggcctgctgcaggcctaccgcttcatcgccgacagc
cgcgacgaagccaccgccgaacgcctggacaacctcgaagacccgtaccgcctgttccgc
tgccacacgatcatgaactgcgtcgacgtgtgcccgaagaacctgaacccgaccaaggcg
atcggcaagatcaaggaactgatggtgcgccgcgccatctga

DBGET integrated database retrieval system