KEGG   Variovorax paradoxus B4: VAPA_1c15210Help
Entry
VAPA_1c15210      CDS       T02835                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit SdhA
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00020  Citrate cycle (TCA cycle)
vpd00190  Oxidative phosphorylation
vpd00650  Butanoate metabolism
vpd01100  Metabolic pathways
vpd01110  Biosynthesis of secondary metabolites
vpd01120  Microbial metabolism in diverse environments
vpd01130  Biosynthesis of antibiotics
vpd01200  Carbon metabolism
Module
vpd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAPA_1c15210 (sdhA)
   00650 Butanoate metabolism
    VAPA_1c15210 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    VAPA_1c15210 (sdhA)
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     VAPA_1c15210 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     VAPA_1c15210 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 FAD_binding_3 HI0933_like GIDA Pyr_redox_3 FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGU48633
UniProt: T1X7W9
LinkDB All DBs
Position
1:complement(1656946..1658754)
Genome map
AA seq 602 aa AA seqDB search
MTYTKENITKRKFDVVIVGAGGSGMRASLQLARAGLNVAVLSKVFPTRSHTVAAQGGVGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQKNVEARTQFFVEWMALDLIRDAEG
DVVGVTALEMETGDLHILQAKTVLLATGGAGRIFQASTNAFINTGDGLGMAARSGIPLQD
MEFWQFHPTGVAGAGVLLTEGCRGEGAILLNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDYVLLKLDHLGAETIHKRLPSVYEIGVNFANVDITKEPIPVVPTIHYQ
MGGIPTNINGQVVIQQGDQNSAVVNGLYAVGECSCVSVHGANRLGTNSLLDLLVFGRAAG
NHIVEFNDKLKEHKPLPADAADRTLERLNRLEAATDGEYAQDVAGEIRAVMQQHAAVFRK
QASMDEGVVKIAAVRERVNAIGLKDKSKVFNTARIEALEVDNLIEVAQATMVSAAARKEC
RGAHTVEDYERPADDPVAPLGRDDANWMKHTLWYSQDNRLSYKPVNLKPLTVDSVPPKVR
TF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacctacacaaaagaaaatatcaccaagcgcaagttcgacgtcgtgatcgtcggtgcc
ggcggctccggcatgcgcgcctcgctgcaactggcccgtgccggcctcaatgtggcggtg
ctctccaaggtgttccccacccgttcgcacaccgtcgccgcgcaaggcggcgtgggcgca
tcgctgggcaacatgagcgaggacaactggcactaccacttctacgacacgatcaagggt
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgcgaagccccgaaggtc
gtgtacgagctcgagcacttcggcatgcccttcgaccgcaaccccgacggcacgatctac
cagcgtcccttcggcggccacacggccaactacggcgagaagcccgtgcagcgcgcctgc
gccgcggccgaccgcaccggccacgcgatgctgcacacgctctaccagaagaacgtcgag
gcacgcacgcagttcttcgtcgagtggatggcactcgacctgatccgcgacgccgaaggc
gacgtggtcggcgtgaccgcgctcgaaatggaaaccggcgacctgcacatcctgcaggcc
aagaccgtgctgctggccaccggcggcgcaggccgcatcttccaggcctcgaccaacgcc
ttcatcaacaccggcgacggcctcggcatggccgcgcgttcgggcattccgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgccggcgtgctgctgaccgaa
ggctgccgcggcgaaggcgccatcctgctcaacagcaacggcgaacgcttcatggagcgc
tatgcgcccacgctgaaggacctggcgccgcgcgacttcgtctcgcgctcgatggaccag
gaaatcaaggaaggccgcggctgcggtcccaacaaggactacgtgctgctgaagctcgac
cacctcggcgccgagaccatccacaagcgcctgccctcggtgtacgaaatcggcgtgaac
ttcgccaacgtcgacatcaccaaggagccgatccccgtggtgccgaccatccactaccag
atgggcggcattccgaccaacatcaacggccaggtcgtgattcagcaaggcgaccagaac
agcgccgtggtgaacggcctctatgcggtgggcgaatgctcctgcgtgagcgtgcacggc
gccaaccgcctgggcaccaattcgctgctcgacctgctggtgttcggccgcgcggccggc
aaccacatcgtcgagttcaacgacaagctgaaggagcacaagccgctgccggccgatgcc
gccgaccgcacgctggagcgcctgaaccgcctcgaggcagccaccgacggcgaatacgca
caggacgtggcgggcgagatccgcgccgtcatgcagcagcacgcggccgtgttccgcaag
caggcctcgatggacgagggcgtggtcaagatcgccgccgtgcgcgagcgcgtcaacgcg
atcggcctgaaggacaagtcgaaggtgttcaacaccgcccgcatcgaagcgctcgaagtc
gacaacctgatcgaagtggcgcaggccaccatggtttcggctgccgcccgcaaggaatgc
cgcggcgcgcacacggtcgaagactacgaacgcccggccgacgacccggtcgcgccgctc
ggccgcgacgacgccaactggatgaagcacacgctctggtacagccaggacaaccgcctc
tcctacaagccggtcaacctcaagccgctgacggtcgactccgttcctcccaaggtccgt
acgttctaa

DBGET integrated database retrieval system