KEGG   Variovorax paradoxus B4: VAPA_1c26780Help
Entry
VAPA_1c26780      CDS       T02835                                 

Definition
(GenBank) zinc-type alcohol dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
vpd  Variovorax paradoxus B4
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VAPA_1c26780
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     VAPA_1c26780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 2-Hacid_dh_C ThiF
Motif
Other DBs
NCBI-ProteinID: AGU49776
UniProt: T1XBB2
LinkDB All DBs
Position
1:complement(2842429..2843466)
Genome map
AA seq 345 aa AA seqDB search
MLNCEIHGALDLRLAERPAEPLAPTQVRVAVKAVGICGSDLHYYRHGRVGDFVIRAPLTP
GHEASGQVVEVGAQVSSVKPGDRVAINPSRTCGVCRFCRAGTSNHCENVHFFGSASRWPH
MQGAMREQVVVEATQCLAVPDTLSFELAAFGEPLAVALHAVQEAGSLLGKTVMVVGAGPI
GALILMAAKLAGASQLIAVDIVDETLAACTRVGATRTINAAREPDALQALAADKGQVDAS
FEVSGHYDGLANCIRSTRPRGTIVQVGTLGGNSEGCPFNQVMVKSLHLVGSFRFVDEYAW
AVDYLSRGVLDVSPLLTEAVPVARVHDAFALAADRHRAMKVLVTF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctgaactgcgaaatccacggcgcgctcgacctgcgccttgccgaacgccccgccgaa
ccgctcgcgcccacccaggtgcgcgtggccgtcaaggcggtgggcatctgcggctccgac
ctgcactactaccgccacggccgcgtcggcgacttcgtgatccgcgcaccgctgacgccg
gggcacgaggcctcgggccaggtcgtggaagtgggcgcgcaggtcagctcggtgaagccg
ggcgaccgcgtcgccatcaatccctcgcgcacctgcggtgtctgccgcttctgccgcgcg
ggcacctccaaccactgcgagaacgtgcacttcttcggcagcgccagccgctggccccac
atgcagggcgcgatgcgcgagcaggtggtggtcgaagccacgcagtgcctcgccgtgcct
gacacgctgtcgttcgaactggccgccttcggcgagccgctggccgtggcgctgcatgcg
gtgcaggaggccggctcgctgctcggcaagacggtgatggtggtgggcgccggcccgatc
ggcgcgctgatcctcatggccgcgaagctcgcgggtgccagccagctgatcgcggtggac
atcgtggacgagacgctcgcggcctgcacccgcgtcggcgcgacgcgcaccatcaacgcg
gccagggagcccgatgcgctgcaggcgctggccgcggacaagggccaggtcgatgcgagc
ttcgaggtctcgggccactatgacggcctggccaactgcatccggtcgacgcgcccgcgc
ggcaccatcgtgcaagtgggcacgctcggcggcaacagcgagggctgcccgttcaaccag
gtcatggtcaagagcctgcacctcgtcggcagcttccgcttcgtcgacgaatacgcctgg
gcggtggactacctgagccgcggcgtgctcgacgtgtcgccgctcctgaccgaggcggtg
ccggtggcgcgcgtgcacgacgccttcgcgctggcggcggatcgtcatcgcgcgatgaag
gtgctcgtcacgttctga

DBGET integrated database retrieval system