KEGG   Variovorax paradoxus B4: VAPA_1c28190Help
Entry
VAPA_1c28190      CDS       T02835                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd03030  DNA replication
vpd03410  Base excision repair
vpd03420  Nucleotide excision repair
vpd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    VAPA_1c28190
   03410 Base excision repair
    VAPA_1c28190
   03420 Nucleotide excision repair
    VAPA_1c28190
   03430 Mismatch repair
    VAPA_1c28190
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:vpd03032]
    VAPA_1c28190
   03400 DNA repair and recombination proteins [BR:vpd03400]
    VAPA_1c28190
Enzymes [BR:vpd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     VAPA_1c28190
    6.5.1.6  DNA ligase (ATP or NAD+)
     VAPA_1c28190
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     VAPA_1c28190
DNA replication proteins [BR:vpd03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    VAPA_1c28190
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     VAPA_1c28190
DNA repair and recombination proteins [BR:vpd03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     VAPA_1c28190
   NER (nucleotide excision repair)
    Other NER factors
     VAPA_1c28190
   MMR (mismatch exicision repair)
    Other MMR factors
     VAPA_1c28190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M ParA
Motif
Other DBs
NCBI-ProteinID: AGU49916
UniProt: T1XBQ0
LinkDB All DBs
Position
1:2982779..2983630
Genome map
AA seq 283 aa AA seqDB search
MLNRRSLLLAGLGALAARVAAAREAAPALMLAEVYRPGMSLADYWVSEKFDGVRGYWDGQ
QLWTRGGEPVVAPAWFIAPLPKQPLDGELWAGRGQFAHAVSTVRSQTPSDTAWHGMRFMV
FDLPAQGGDFTARLAVLRKLLPITDAPWVVPVPQERATTHAELQALLAKTVKMGGEGLML
HRGGSLYRAERNSDLLKVKPHDDAEARVVGHMPGKGRHSGRLGALLVETPEGRRFKLGSG
LTDAERENPPAVGSWVTYRYNGTNPGGLPRFARFMRVRSDLPS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaacagacgttccctcctgctcgccggcctcggcgcgctggcggcccgcgtggcc
gccgcgcgcgaggccgcgccggcattgatgctggccgaggtctaccgccccggtatgtcg
ctggccgactactgggtcagcgaaaaattcgacggcgtgcgcggctactgggacggccag
cagctgtggacgcgcggcggcgaaccggtggtggcgcccgcctggttcatcgcgccgctg
ccgaagcagccgctcgacggcgaactgtgggccggcaggggccagttcgcgcacgcagtt
tccaccgtgcgcagccagacacccagcgacaccgcctggcacggcatgcgcttcatggtg
ttcgacctcccggcccagggcggcgatttcacggcgcggctggctgtcttgcgcaagctg
ctgccgatcaccgatgcgccgtgggtggtgcccgtgccgcaggagcgcgcaaccacccat
gcggagctgcaggccctgctcgccaagacggtgaagatgggcggcgaaggcctgatgctg
caccggggtggatcgctctaccgtgccgaacgcaacagcgacctgctcaaggtcaagccc
cacgacgacgccgaggcccgggtggtcgggcacatgcccggcaaaggccggcacagcggc
cgattgggcgcactgctggtcgaaacccccgagggcaggcgcttcaagctcggcagcggc
ctgaccgacgccgagcgcgagaacccgcccgctgtcggaagctgggtgacgtaccgctac
aacggcaccaatccgggcggcctgcccaggttcgcccgcttcatgcgggtgcgcagcgac
ctgccctcctga

DBGET integrated database retrieval system