KEGG   Variovorax paradoxus B4: VAPA_1c33390Help
Entry
VAPA_1c33390      CDS       T02835                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VAPA_1c33390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpd02000]
    VAPA_1c33390
Enzymes [BR:vpd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VAPA_1c33390
Transporters [BR:vpd02000]
 Other Transporters
  Pores ion channels [TC:1]
   VAPA_1c33390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3 GST_C_5 Tom37
Motif
Other DBs
NCBI-ProteinID: AGU50425
UniProt: T1XE56
LinkDB All DBs
Position
1:3530650..3531228
Genome map
AA seq 192 aa AA seqDB search
MMKLYFDPQSRSQVAKWMLDEAGVDYEIVPTLIREKAHKKPDYLKINPAGKLPALVDGRT
RVFENAAICMYVAEKFPQARLAPSVGSPDRGRYLSLMVYSTAQLEPSMGDSLLGLHSNNS
ARGWTHFEQAKDAVERELGYGPYLFGAQFTAADVMIGSMFIWHRAFGGRSNRPKIDAYID
RLQARPKGMKFG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagctgtatttcgatccacagagccgctcgcaggtcgcgaaatggatgctcgac
gaagccggcgtggactacgaaatcgtgcccaccctcatccgggagaaggcgcacaagaaa
cccgattacctgaagatcaatcccgccggcaagctgccggcgctggtcgacggccgcacc
cgcgtcttcgagaatgcggccatctgcatgtacgtggccgagaagtttccgcaggccagg
ctggcaccgtccgtgggctcgcccgaccgcggccgctacctgtcgctgatggtctattcg
acggcgcagctcgaaccctcgatgggcgacagcctgctcgggctgcacagcaacaacagc
gcgcgcggctggacccatttcgagcaggccaaggatgcggtggaacgcgaactgggctat
ggcccgtatctcttcggtgcgcagttcaccgcggccgacgtgatgatcggctcgatgttc
atctggcaccgcgcattcggcgggcgctcgaaccggcccaagatcgatgcctacatcgac
cgcctgcaggcccgccccaagggcatgaagttcggctga

DBGET integrated database retrieval system