KEGG   Variovorax paradoxus B4: VAPA_1c47770Help
Entry
VAPA_1c47770      CDS       T02835                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VAPA_1c47770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpd02000]
    VAPA_1c47770
Enzymes [BR:vpd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     VAPA_1c47770
Transporters [BR:vpd02000]
 Other Transporters
  Pores ion channels [TC:1]
   VAPA_1c47770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGU51843
UniProt: T1XGZ7
LinkDB All DBs
Position
1:complement(5036458..5037132)
Genome map
AA seq 224 aa AA seqDB search
MLTVHHLNNSRSQRALWLLEELGLPYEIVHYQRDPQTMLAPASLRAVHPLGKSPVVTTDD
GLALAESGAVIETLIERHGNGRLAPAAGTPEAVRYRYWLHFAEGSAMSPLLLKLVFDKIE
NSKMPFFVKPIAKMISGKAKAAIVMPNIESHLDFMEAELGKSEWFAGNEFTGADIQMSFP
VEASQARGGLDAKRPRLMAYLERIHARPAYQRALERGGPYGLLS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccgtccaccacctcaacaactcgcgctcgcagcgcgcgctctggctgctcgaa
gaactcggcctgccctacgagatcgtccactaccagcgcgatccgcagaccatgttggcg
cccgcttcgctgcgggccgtgcatccgctcggcaagtcgccggtggtgaccacggacgac
ggcctggcgctggcggagtcgggtgcggtcatcgaaacgctgatcgagcgccacggcaac
ggccggctggcgcccgcggcgggcacgccggaggctgtgcgctatcgctactggctgcat
ttcgcggaaggctcggccatgtcgccgctgctgctcaagctggtgttcgacaagatcgag
aacagcaagatgcccttctttgtgaagccgatcgcgaagatgatctccggcaaggccaag
gcggccatcgtcatgcccaacatcgagagccacctggatttcatggaagccgaactcggc
aagagcgagtggttcgccggcaacgagttcaccggcgccgacatccagatgagttttccg
gtcgaagcctcgcaggcgcgcggcggcctcgatgcgaagcggcccaggctcatggcgtac
ctggagcgcatccacgcgcgcccggcctaccagcgcgcgctcgaacgcggcggcccctac
ggcctgctgagctga

DBGET integrated database retrieval system