KEGG   Variovorax paradoxus B4: VAPA_1c51870Help
Entry
VAPA_1c51870      CDS       T02835                                 

Gene name
sodB2
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vpd  Variovorax paradoxus B4
Brite
Enzymes [BR:vpd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     VAPA_1c51870 (sodB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2683 DUF4646
Motif
Other DBs
NCBI-ProteinID: AGU52241
UniProt: T1XI85
LinkDB All DBs
Position
1:5455878..5456459
Genome map
AA seq 193 aa AA seqDB search
MEHTLPPLPYALDALAPEYSKETLEYHYGKHHNAYVVNLNNLQKGTEFESMTLEEIVKKS
SGGIYNNAAQIWNHTFFWNCMKPQGGGAPSGALAKAIDAKWGSYDAFKEAFVKSAVGNFG
SGWTWLVKKADGSLDIVNMGAAGTPLTTGDTPVLTVDVWEHAYYIDYRNLRPKFVETFLA
KLANWDFAAKNFG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaccctgccacccctgccctacgccctcgacgcgctggcacccgagtactcg
aaggaaaccctcgagtaccactacggcaagcaccacaatgcctacgtggtgaacctcaac
aacctgcaaaagggcaccgaattcgaatcgatgacgctcgaggagatcgtcaagaagtcc
agcggcggcatctacaacaacgccgcccagatctggaaccacaccttcttctggaactgc
atgaagccccagggcggcggcgctccgagcggtgcgctggccaaggccatcgatgccaag
tggggcagctacgacgccttcaaggaagcgttcgtgaagtcggccgtgggcaacttcggc
tcgggctggacctggctggtgaagaaggccgacggctcgctggacatcgtgaacatgggt
gccgcgggcacgccgctgaccaccggcgacaccccggtgctgacggtggacgtctgggag
cacgcctactacatcgactaccgcaacctgcgcccgaagttcgtggagaccttcctggcc
aagctggcgaactgggacttcgcggcaaagaacttcggctga

DBGET integrated database retrieval system