KEGG   Variovorax paradoxus B4: VAPA_2c01390Help
Entry
VAPA_2c01390      CDS       T02835                                 

Definition
(GenBank) ribulose bisphosphate carboxylase-like protein
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00630  Glyoxylate and dicarboxylate metabolism
vpd00710  Carbon fixation in photosynthetic organisms
vpd01100  Metabolic pathways
vpd01120  Microbial metabolism in diverse environments
vpd01200  Carbon metabolism
Module
vpd_M00165  Reductive pentose phosphate cycle (Calvin cycle)
vpd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VAPA_2c01390
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VAPA_2c01390
Enzymes [BR:vpd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VAPA_2c01390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N ATP_transf
Motif
Other DBs
NCBI-ProteinID: AGU52702
UniProt: T1XIJ0
LinkDB All DBs
Position
2:134831..136060
Genome map
AA seq 409 aa AA seqDB search
MRARYWLETGDNPERAAEVIAGEQSSGTFTAVPGETPALKERSGAHVERVHVLGRVGTPS
LPTRQRAASYTQCVLDLSWPLANFGVSLPNLMATVAGNLFELRQVSGLRLLDLAVPQAFV
DGCPGPAFGIAGTRALSGVARGPLVGTIVKPSVGLSPAETAETVRALVAGGIDFIKDDEL
QADGPHCPFDERVRAVMVVVREAAERTGRKPMVAFNLTGEVDEMRRRHDLVLAQGGTCVM
VSLNSVGLAGLLALRRHAQLPIHAHRNGWGYLNRCPALGWDFAPWQTLWRLAGADHLHVN
GLANKFSESDESVIAAARAVLAPLSARNPMAAMPVFSSGQTGLQAAPTYAALGTTDLIHA
AGGGILGHPGGIAAGVAAMRQAWQAAVAGVPLTTHATAHAELAQALEVW
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcacgctactggctggaaaccggcgacaaccccgagcgcgccgccgaagtcatc
gcgggcgagcagtccagcggcaccttcacggccgtgcccggcgagacgcccgcgctcaag
gagcgctcgggcgcgcacgtggagcgcgtgcacgtgctcggccgcgtgggcacgccaagc
ctgcccacgcgccagcgcgccgcgagctacacgcagtgcgtgctcgacctgtcgtggccg
ctggcgaacttcggcgtctcgctgcccaacctgatggccaccgtggcgggcaacctgttc
gagctgcggcaggtctcgggcctgcgcctgctcgacctggcagtgccgcaggccttcgtc
gacggctgccccggcccggccttcggcattgcgggcacgcgcgcgctctcgggcgtggcg
cgcggcccgctggtcggcaccatcgtcaagcccagcgtgggcctgtcgcccgccgagacg
gccgagaccgtgcgcgcactcgtggccggcggcatcgacttcatcaaggacgacgagctg
caggccgacggcccgcactgcccgttcgacgagcgcgtgcgcgccgtcatggtcgtggtc
cgcgaggcggccgagcgcaccgggcgcaagcccatggtggccttcaacctcacgggcgag
gtcgacgagatgcgccgccgccacgacctggtgctggcgcagggcggcacctgcgtgatg
gtcagcctgaactcggtgggcctcgccgggctgctcgcgctgcgccgccatgcgcaattg
ccgatccatgcgcaccgcaatggctggggctacctgaaccgctgccccgcgctcggctgg
gacttcgcgccctggcagacgctgtggcgcctggcgggtgccgatcacctgcacgtgaac
ggcctggccaacaagttcagcgagagcgacgaaagcgtgatcgccgcggcgcgcgccgtg
ctggcaccgctgtccgcgcgcaatcccatggccgcgatgcctgttttcagctcgggccag
accgggctgcaggccgcgccgacctatgcggcgctcggcaccaccgacctcatccatgcc
gccggcggcggcatcctcggccacccggggggcatcgccgcgggcgtggccgcaatgcgc
caggcctggcaggccgccgtggccggcgtgccgctgaccacgcacgcgaccgcgcacgcc
gagctcgcccaggcgctcgaggtctggtga

DBGET integrated database retrieval system