KEGG   Variovorax paradoxus B4: VAPA_2c11770
Entry
VAPA_2c11770      CDS       T02835                                 

Gene name
palA
Definition
(GenBank) putative phosphonopyruvate hydrolase PalA
  KO
K19669  phosphonopyruvate hydrolase [EC:3.11.1.3]
Organism
vpd  Variovorax paradoxus B4
Pathway
vpd00440  Phosphonate and phosphinate metabolism
vpd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    VAPA_2c11770 (palA)
Enzymes [BR:vpd01000]
 3. Hydrolases
  3.11  Acting on carbon-phosphorus bonds
   3.11.1  Acting on carbon-phosphorus bonds (only sub-subclass identified to date)
    3.11.1.3  phosphonopyruvate hydrolase
     VAPA_2c11770 (palA)
SSDB
Motif
Pfam: PEP_mutase ICL
Other DBs
NCBI-ProteinID: AGU53731
UniProt: T1XMG2
LinkDB
Position
2:1205746..1206618
AA seq 290 aa
MTKNKTLRNALESGKLLTAMAAHNPLAAKLAEEAGFGGIWGSGFELSASYAVPDANILSM
GTHLEMMRAIASVVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTSL
RTEGRQELVRAEEFQGKIAAACAARKDRDFVVVARVEALIAGLGQDEAIRRGLAYAEAGA
DAILIHSKQKTPDEILNFVTAWPAKVPLVLVPTAYPQLSEADIEGLRKVGVVIYGNHAIR
AAVGAMRKVFRQIRAEGGIRAVDPLLPSVKDIIELQGDASMRAVESSFLR
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaccaagaacaagacacttcggaatgcgctcgagagcggcaagctgttgacagcgatg
gccgcccacaaccccctggccgcgaaactggcggaagaagccggcttcggcggcatctgg
ggcagcggcttcgagctttcggccagctatgcggtgccggatgccaacatcctctcgatg
ggaacgcacctcgagatgatgcgtgcgatcgccagcgtcgtctcgattccactcatcgcg
gacatcgacaccggtttcggcaacgccgtgaacgtccactacgtcgtcccgcaatacgag
gcggcgggtgcgtcggccatcgtcatggaggacaagacatttcccaaggacacgagcctg
cgcacggagggtcgccaggagctggtccgcgctgaagagttccagggaaagatcgccgca
gcctgcgctgcccgcaaggaccgcgatttcgtggtggtcgcgagggtggaggcgttgatc
gccggactcggacaggacgaggcaatcaggcgaggcctggcctacgcagaggccggcgcc
gacgccatcctcatccactccaagcagaagacaccggacgagatcctaaatttcgtcacc
gcctggcctgcaaaggtgccactggtcctggtcccgaccgcctatcctcagttgtccgag
gccgacatcgagggccttcgaaaagtcggcgtcgtgatctacggcaatcatgcgatccgc
gctgcggtcggtgcgatgcgcaaggtgtttcgtcagatccgagcagagggcggaatccgg
gccgtggacccgctccttccatcagtgaaagacatcatcgagctgcagggcgatgcatcg
atgcgggcagtcgagtcgagcttcttaaggtga

DBGET integrated database retrieval system