KEGG   Variovorax paradoxus EPS: Varpa_0047Help
Entry
Varpa_0047        CDS       T01392                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Varpa_0047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vpe02000]
    Varpa_0047
Enzymes [BR:vpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Varpa_0047
Transporters [BR:vpe02000]
 Other Transporters
  Pores ion channels [TC:1]
   Varpa_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N GST_N_3 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ADU34270
UniProt: E6UXS6
LinkDB All DBs
Position
complement(50203..50811)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALHEAGLAFEPVMASTKSHKLQDGTDYYGINPLGYVPMLELDDG
TRLREGPAIVQYIADLAPTKNLAPANGTLQRYRLQEWLTFIGTEMHKGYSPLFNPNMPEE
AKTIFKDKLKSRYEWLDGQLADKQYLMGEHFSVADGYLFTVTNWTKPTGVDISAFANVQA
WHARVAARPAVQEAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtattactcgcccggtgcctgttccctttcgccccacatcgcgctgcacgaa
gcgggccttgccttcgaaccggtgatggccagcaccaagagccacaagctgcaggacggc
accgactactacggcatcaacccgctgggctacgtgccgatgctcgaactggacgacggc
acgcgcctgcgcgaaggcccggccatcgtgcaatatatcgccgacctcgcccccaccaag
aacctcgcgccggccaacggcacgctgcagcgctatcgcctgcaggagtggctcaccttc
atcggcaccgagatgcacaagggctacagcccgctgttcaacccgaacatgcccgaggaa
gccaagaccatcttcaaggacaagctcaagtcgcgctacgaatggctcgacggccagctc
gccgacaagcagtacctgatgggcgagcacttcagcgtggccgacggctacctgttcacc
gtgaccaactggaccaagccgaccggcgtcgacatctcggccttcgccaacgtgcaggcc
tggcatgcgcgcgtggcggcgcgtcccgcagtgcaggaagcgatgaaggccgaaggcctg
ctaaagtaa

DBGET integrated database retrieval system