KEGG   Variovorax paradoxus EPS: Varpa_0290Help
Entry
Varpa_0290        CDS       T01392                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00970  Aminoacyl-tRNA biosynthesis
vpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Varpa_0290
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vpe03029]
    Varpa_0290
Enzymes [BR:vpe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Varpa_0290
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Varpa_0290
Mitochondrial biogenesis [BR:vpe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Varpa_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADU34512
UniProt: E6V1E8
LinkDB All DBs
Position
complement(304966..306456)
Genome map
AA seq 496 aa AA seqDB search
MSETVNTFEAQQQGRPTGPLVRGYEVIIGFETHAQLSTNSKIFSRASTAFGAEPNTQACA
VDLALPGTLPVMNKGAVERAIKLGLALGSHVAPRSVFARKNYFYPDLPKGYQISQFEIPV
VQGGSVSFFLGEEKKTVRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTEPDM
RSTAEAVAYARELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGDKLGTRREIKNLNSFK
FMQQAIDYEIRWQIEEIEDGRKVEQATVLFNPDTGETRAMRAKEDSADYRYFPDPDLPPL
VIAADWIERVRGEMPELPRAMAERYVRDHGLSEYDAAQLTQSLALAHYFDEAVKAGATPK
LASNWITGEMARRLNAKEIGIEAAPVSAQQLGQLVKRIADGTLPNNAARQVFDALWIGEG
SDVDAIIEAKDLKPMADTGALDAILDEVIARNAKNVEEYRGGKEKALNGLVGQVMKASGG
KANPAQVTELLKAKLG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaccgtgaacacattcgaagcacaacaacaaggccgcccgaccggcccgctg
gtgcgcggctatgaagtcatcatcggcttcgagacgcacgcgcagctgtcgacgaacagc
aagatcttcagccgcgcctccacggccttcggcgccgagccgaacacgcaggcctgcgcg
gtggacctcgcgttgcccggcacgctgccggtgatgaacaagggcgcggtcgaacgcgcc
atcaagctgggcctcgcgctcggctcgcacgtggcgccgcgcagcgttttcgcgcgcaag
aactacttctatcccgacctgcccaagggctatcagatcagccagttcgagattccggtc
gtgcagggtggctcggtgtcgttcttcctcggcgaagagaagaagaccgtgcgcctcgtg
cgcgcccacttggaagaagacgcgggcaagtcgctgcacgaggacttcatcggccagagc
ggcatcgacctgaaccgcgccggcacgccgctgctggaaatcgtgaccgagcccgacatg
cgctccaccgccgaggccgtggcttatgcgcgcgagctgcacaagatcgtcacgtggatc
ggcatctgcgacggcaacatgcaggaaggcagcttccgctgcgacgccaacgtgtcggtg
cgcaagcccggcgacaagctgggcacgcggcgcgagatcaagaacctgaacagcttcaag
ttcatgcagcaggcgatcgactacgagatccgctggcagatcgaggagatcgaggacggc
cgcaaggtcgagcaggcgacggtgctcttcaaccccgacaccggcgagacgcgcgcgatg
cgcgccaaggaagactcggccgactaccgctacttccccgaccccgacctgccgccgctg
gtgattgcggccgactggatcgaacgcgtgcgcggcgaaatgcccgagctgccgcgcgcg
atggccgagcgctatgtgcgcgaccatggcctgtcggaatacgacgcggcgcagctcacg
cagagccttgcgctcgcgcactatttcgatgaagcggtgaaggccggcgcgacgccgaag
ctcgcgagcaactggatcaccggcgagatggcgcgtcgtctgaacgcaaaagagatcggc
atcgaagcggcaccggtcagcgcgcagcagcttggccagctggtcaagcgcatcgccgac
ggcacgctgccgaacaacgcggcgcgccaggtgttcgatgccctctggatcggcgaaggc
agcgacgtggacgcgatcatcgaggccaaggacctgaagccgatggccgacaccggtgcg
ctcgacgcgatcctcgacgaagtcatcgccaggaacgcgaagaacgtcgaggaataccgc
ggcggcaaggagaaggcgctcaacggcctcgtgggtcaggtgatgaaggccagcggcggc
aaggccaaccccgcgcaggtcaccgagctgctgaaagccaagctgggctga

DBGET integrated database retrieval system