KEGG   Variovorax paradoxus EPS: Varpa_0994Help
Entry
Varpa_0994        CDS       T01392                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
vpe  Variovorax paradoxus EPS
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vpe03016]
    Varpa_0994
Enzymes [BR:vpe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     Varpa_0994
Transfer RNA biogenesis [BR:vpe03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    Varpa_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: ADU35212
UniProt: E6UUP3
LinkDB All DBs
Position
complement(1108031..1110097)
Genome map
AA seq 688 aa AA seqDB search
MFVLFEEAGKYLGGRVLSEAEASAQVELETGKRVKVKGANIVLRFEKPSPAELIAEARSL
AAAMDLDLAWEFAADGEFGFADLAADYFSDKPTLAQQAAALFALFEAPHYFRRAGKGRFK
KAPAEIVQQALAAIEKKKVIQAQIVEWAGQLAEGVCPQPIREQLYKILFKPDKNAPEYKA
VVDAARATQRPPLDLLERAGAIDSPYQFHWRRFLFENFPKGHGFPALAAPAIADDLPVAT
GVEAFSIDDSQTTEIDDALSVQGLGSGTVTVGIHIAAPALALTPGSAIDNVARARMSTVY
MPGYKITMLPDEVVNTYTLLEGADRPAVSLYARFDEATLELQGTETKLERVPIVANLRHD
QLDAVVTQPWLEDATVTSPDTPEAAANLRAPLSFLFRLAKQLKAQREVVRGKPENFNRPD
YNFRLVGNDGNEPTGNEQVQITTRQRGAPLDLIVSEAMILANSSWGGWLGELGVPGLYRS
QASLAPGIKVRMGTRALPHAGLGVKSYAWSTSPLRRYTDLVNQWQIIAAARHGKTAALAA
PFKPKDADLFSILSGFDAAYATYNGYQGGMERFWTLKYLQQNGITELEATVIKDIPNGAL
VRADALPLVFPVAGQQERGARLRVKLGEIDEIALDVSGTVLERLDAPKADASAEDESGED
EEEVAGPIAIAVDLNDSEAAPENTPAPA
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtattgtttgaagaagccggcaagtacctcggcggccgtgtcctgtcggaggcc
gaagcctcggcgcaggtcgagctcgagaccggcaagcgcgtcaaggtcaagggcgccaac
atcgttctgcgtttcgagaaaccgtctcctgccgagttgatcgccgaggcgcgctcgctc
gccgccgcgatggacctcgacctggcctgggaattcgcagccgacggcgagttcggtttt
gccgacctggccgccgactatttcagtgacaagcccacgctcgcccagcaggcggccgcg
ctgttcgccctcttcgaggcgccgcattacttccgccgtgcaggcaaggggcgcttcaag
aaggcgccggccgaaatcgtgcagcaggcgctcgccgccatcgagaagaaaaaagtcatt
caggcgcagatcgttgaatgggccgggcagttggccgagggcgtgtgcccgcagccaatc
cgcgagcagctctacaagatcctgttcaagcccgacaagaacgcccccgaatacaaggcc
gtggtcgacgccgcgcgcgccacgcagcgcccgccgctcgatctgctggaacgcgccggg
gcgatcgattcgccctaccagttccactggcgccgcttcctcttcgagaacttccccaag
ggccacggcttccccgcgctcgcggcaccggccattgcggacgacctgcctgtcgccacc
ggcgtcgaggccttctcgatcgacgattcgcagaccaccgaaatcgacgatgcactgtcg
gtgcaaggccttggcagcggcaccgtcacggtcggcatccacatcgctgcaccggccctg
gcactcacgccgggcagcgccatcgacaacgtcgcgcgtgcgcgcatgtcgacggtctac
atgccgggctacaagatcacgatgctgcccgacgaggtggtcaacacctacacgctgctc
gaaggcgccgaccgcccggccgtgtcgctctacgcgcgattcgacgaagccacgctcgaa
ctgcagggcaccgagaccaagctcgaacgcgtgccgatcgtcgccaacctgcgccacgac
caactcgacgccgtcgtcacgcagccctggctcgaagacgccacggtcacgagccccgac
acgcccgaggccgccgcgaacctgcgcgccccgctctccttcctgttccgcctcgccaaa
caattgaaggcgcaacgcgaagtggtgcgcggcaagcccgagaacttcaaccggcccgac
tacaacttccgcctcgtcggcaacgacggcaacgaacccaccggcaacgagcaggtgcag
atcacgacgcgccagcgcggcgcgccgctcgacctgatcgtctcggaagcgatgatcctg
gccaacagcagctggggcggctggctcggcgaactcggcgtgcccgggctctaccgcagc
caggcgagcctggcgcccggcatcaaggtgcgcatgggcacgcgcgcgctgccgcatgcg
ggcctgggcgtgaagagctatgcgtggagcacctcgccgctgcgccgctacaccgacctg
gtgaaccagtggcagatcatcgcggccgcccgccacggcaagaccgccgcgctggccgcg
cccttcaagccgaaggacgccgacctgttctcgatcctctcgggcttcgacgcggcctat
gccacctacaacggctaccagggcggcatggagcgcttctggacgctcaagtacctgcag
cagaacggcatcaccgagctcgaagcgacggtcatcaaggacatccccaacggcgcgctg
gtgcgtgccgatgcgttgccgctggtgttcccggtcgcgggccagcaggagcgcggtgcg
cgcctgcgcgtgaagctcggcgagatcgacgagattgcgctcgacgtgagcggcaccgtg
ctcgagcgcctcgatgcaccgaaggccgatgcgtcggcggaagacgaaagcggcgaggat
gaagaagaagtcgccggcccgatcgccattgccgtcgatttgaacgacagcgaggccgcg
ccggaaaacacacccgcacctgcatga

DBGET integrated database retrieval system