KEGG   Variovorax paradoxus EPS: Varpa_1108Help
Entry
Varpa_1108        CDS       T01392                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00010  Glycolysis / Gluconeogenesis
vpe00052  Galactose metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Varpa_1108
   00052 Galactose metabolism
    Varpa_1108
Enzymes [BR:vpe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Varpa_1108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADU35326
UniProt: E6UWM9
LinkDB All DBs
Position
1242848..1243921
Genome map
AA seq 357 aa AA seqDB search
MSSSITSREYGRMPDGRVVTEYTLDNGRGLSLSAINHGGIVTALRVPDRDGQAANIVLGL
PSLDDYMKPHPHFGTIVGRYANRIAAGRFPLDGTAHQLGLNDGVNSLHGGAKGFGTRFWQ
IEPVSAEDARGDIAIELRYTSADGEEGYPGEVQLTVRYTLSATENTWRIDYRATTDKPTV
LNLSHHDYFNLAGSGDVMDHVLTLPANRYCPVDATLIPPGLAEVGATPFDFRTPARIGER
IREGHEQLLRAHGYDHNWVLDGDRGGDGLALAARLAHEASGRVMEVHTTEPGVQFYSGNF
LDGSLMGSQGASLRQGDGLCLETQHYPDSPNQPGFPSTVLRPCEVFRSTTEHRFSVG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagcatcacctcacgtgaatacggccgcatgcccgatgggcgcgtagtgacc
gaatacaccctcgacaacggccgtggcctcagcttgagtgccatcaaccacggcggcatc
gtcaccgcgctgcgcgtgcccgaccgagacggacaggccgcgaatattgtgctgggtctg
ccttcgctcgacgactacatgaagccgcatccgcacttcggcaccatcgtcggccgctat
gcgaaccgcatcgcggcggggcgtttcccgctcgatggcactgcgcaccaactgggcctg
aacgacggtgtgaattccctgcacggcggcgcgaaaggcttcggcacgcgtttctggcag
atcgagccggtgtccgcggaggacgcgcgcggcgacatcgccatcgagctgcgctacacg
agcgccgatggcgaagagggttaccctggcgaagtgcagctcaccgtgcgctacacgctc
tcggcgaccgagaatacctggcgcatcgattaccgcgcgacgaccgacaagccgacggtg
ctgaacctgagccaccacgactacttcaacctcgccggcagcggcgacgtgatggaccat
gtgctgacgctgcccgcgaaccgctactgcccggtggatgcgacgctgatcccgcccggg
ttggcggaggtgggcgcgacgcccttcgatttccgcacgccggcgcgcatcggtgaacgc
atccgcgaagggcacgagcagttgctgcgcgcgcacggctacgaccacaactgggtgctc
gatggcgaccgcggcggcgatggcctcgcattggccgcacgccttgcgcacgaagcctcc
ggccgcgtgatggaagtgcacaccaccgagcctggcgtgcagttctattcgggcaacttc
ctcgacggcagcctcatgggttcgcaaggtgcgagcctgcggcagggcgatggcctctgc
ctggagacgcagcactacccggattcgccgaaccagccgggctttccgtcgaccgtgctg
cggccgtgcgaggtgttccgcagcacgacggaacaccggttcagcgtcggttga

DBGET integrated database retrieval system