KEGG   Variovorax paradoxus EPS: Varpa_1571Help
Entry
Varpa_1571        CDS       T01392                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00020  Citrate cycle (TCA cycle)
vpe00190  Oxidative phosphorylation
vpe00650  Butanoate metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01200  Carbon metabolism
Module
vpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Varpa_1571
   00650 Butanoate metabolism
    Varpa_1571
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Varpa_1571
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Varpa_1571
    1.3.5.4  fumarate reductase (quinol)
     Varpa_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4_16 Fer4 Fer4_4 Fer2
Motif
Other DBs
NCBI-ProteinID: ADU35782
UniProt: E6V3K2
LinkDB All DBs
Position
complement(1744072..1744773)
Genome map
AA seq 233 aa AA seqDB search
MKRTFQIYRYDPDKDAKPYMQTIEIELDGHERMLLDALMKLKAQDPTLSFRRSCREGVCG
SDAMNINGKNGLACLTNMLTLKGTIVLKPLPGLPVIRDLIVDMTQFFKQYNSIKPYLQND
NVPPEKERLQSPEEREELNGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIADS
RDEATAERLDNLEDPYRLFRCHTIMNCVDVCPKNLNPTKAIGKIKELMVRRAI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcacattccagatctaccgctacgacccggacaaggacgccaagccctacatg
cagaccatcgagatcgaactcgacggccacgaacgcatgctgctggacgccctgatgaag
ctcaaggcgcaagacccgacgctgtcgttccgccgctcgtgccgcgaaggcgtctgcggt
tccgacgcgatgaacatcaacggcaagaacggccttgcctgcctcaccaacatgctcacg
ctcaagggcacgatcgtgttgaagccgctgccgggcctgcccgtcattcgcgacctgatc
gtggacatgacgcagttcttcaagcagtacaactcgatcaagccgtacctgcagaacgac
aacgtgccgcccgagaaggaacgcctgcagtcgcccgaagagcgcgaagagctcaacggc
ctgtacgaatgcatcctgtgcgcgagctgctccacgagctgcccgagcttctggtggaat
cccgacaagttcgtcggcccggcaggcctcctgcaggcctaccgcttcatcgccgacagc
cgcgacgaagccaccgccgagcgcctggacaacctggaagacccgtaccgcctgttccgc
tgccacacgatcatgaactgcgtcgacgtgtgcccgaagaacctgaaccccaccaaggcc
atcggcaagatcaaggaattgatggtgcgtcgcgccatctga

DBGET integrated database retrieval system