KEGG   Variovorax paradoxus EPS: Varpa_1572Help
Entry
Varpa_1572        CDS       T01392                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
vpe  Variovorax paradoxus EPS
Pathway
vpe00020  Citrate cycle (TCA cycle)
vpe00190  Oxidative phosphorylation
vpe00650  Butanoate metabolism
vpe01100  Metabolic pathways
vpe01110  Biosynthesis of secondary metabolites
vpe01120  Microbial metabolism in diverse environments
vpe01130  Biosynthesis of antibiotics
vpe01200  Carbon metabolism
Module
vpe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
vpe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Varpa_1572
   00650 Butanoate metabolism
    Varpa_1572
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Varpa_1572
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Varpa_1572
    1.3.5.4  fumarate reductase (quinol)
     Varpa_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO FAD_binding_3 HI0933_like GIDA FAD_oxidored Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADU35783
UniProt: E6V3K3
LinkDB All DBs
Position
complement(1744821..1746629)
Genome map
AA seq 602 aa AA seqDB search
MTYTKEQITKRKFDVVIVGAGGSGMRASLQLARAGLNVAVLSKVFPTRSHTVAAQGGVGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPKVVYELEHFGMPFDRNPDGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHAMLHTLYQKNVEARTQFFVEWMALDLIRDDEG
DVVGVTALEMETGDLHILQAKTVLLATGGAGRIFQASTNAFINTGDGLGMAARSGIPLQD
MEFWQFHPTGVAGAGVLLTEGCRGEGAILLNSNGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGCGPNKDYVLLKLDHLGADTIHKRLPSVYEIGVNFANVDITKEPIPVVPTIHYQ
MGGIPTNINGQVVIQKGEDNSAVVNGLYAVGECSCVSVHGANRLGTNSLLDLLVFGRAAG
NHIVEFNDKLKEHKELPKDAADRTLERLNRLESTTTGEYAQDVAGEIRAVMQQHAAVFRK
QASMDEGVVKIAAVRERVNSIGLKDKSKVFNTARIEALEVDNLIEVAQATMVSAAARREC
RGAHTVEDYERPADDPVAPLGRDDANWMKHTLWYSQDNRLSYKPVKLQPLTVASVPPKVR
TF
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacctatacaaaagaacaaatcaccaagcgcaagttcgacgtcgtgatcgtcggtgcc
ggcggctccggcatgcgcgcttcgctgcaactcgcacgcgccggcctcaacgtggctgtg
ctctccaaggtgttccccacccgttcgcacaccgtcgccgcgcaaggcggcgtgggcgca
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgcgaagccccgaaggtc
gtgtacgagctcgagcacttcggcatgcctttcgaccgcaaccccgacggcacgatctac
cagcgcccgttcggcggccacacggccaactacggcgagaagcccgtgcagcgcgcctgc
gccgcggccgaccgcaccggccacgcgatgctgcacacgctctatcaaaagaacgtcgag
gcgcgcacccagttcttcgtcgaatggatggcgctggacctcatccgtgacgacgaaggt
gacgtggtcggcgtgaccgcgctcgaaatggaaaccggcgacctgcacatcctgcaggcc
aagaccgtgctgctggccaccggcggcgcgggccgcatcttccaggcctcgaccaacgcc
ttcatcaacaccggcgacggcctgggcatggccgcgcgctcgggcattccgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgcttctgaccgaa
ggctgccgcggcgaaggcgccatcctgctcaacagcaacggcgaacgcttcatggagcgc
tatgcgcccacgctgaaggacctggcgccgcgcgacttcgtctcgcgctcgatggaccag
gaaatcaaggaaggccgaggctgcggtcccaacaaggactacgtgctgctcaagctcgac
cacctgggcgccgacaccatccacaagcgcctgccttcggtgtacgaaatcggcgtcaac
ttcgccaacgtcgacatcacgaaggaaccgattcccgtcgtgccgaccatccactaccag
atgggcggcatcccgaccaacatcaacggccaggtcgtcatccagaagggcgaggacaac
agcgccgtggtaaacggcctctacgcggtgggcgaatgctcctgcgtgagcgtgcacggc
gcgaaccgcctgggcacgaactcgctgctcgacctcttggtgttcggccgcgcggccggc
aaccacatcgtcgagttcaacgacaagctgaaggaacacaaggaactcccgaaggatgcg
gccgaccgcacgctggagcgtctgaaccgcctcgaatcgaccaccaccggcgaatacgca
caggacgtggccggcgagatccgcgccgtcatgcaacagcacgccgcggtgttcaggaag
caagcctcgatggacgaaggcgtggtcaagatcgccgccgtgcgcgagcgcgtcaattcg
atcggcctgaaggacaagtccaaggtgttcaacaccgcccgcatcgaagcgctggaagtc
gacaacctgatcgaagtggcgcaggccacgatggtctcggccgccgcccgccgcgaatgc
cgcggcgcccacacggtggaagactacgagcgccccgcggacgacccggtcgcgccgctc
ggccgcgacgacgccaactggatgaagcacacgctctggtacagccaggacaaccgcctc
tcgtacaagccggtcaagctgcagccgctcacggtggcctcggttccaccgaaggtccgc
acgttctaa

DBGET integrated database retrieval system