KEGG   Variovorax paradoxus EPS: Varpa_2069Help
Entry
Varpa_2069        CDS       T01392                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vpe  Variovorax paradoxus EPS
Brite
KEGG Orthology (KO) [BR:vpe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Varpa_2069
Enzymes [BR:vpe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Varpa_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 Glutaredoxin HI0933_like FAD_binding_3 AlaDh_PNT_C DAO K_oxygenase FMO-like Thi4 Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADU36276
UniProt: E6VAS2
LinkDB All DBs
Position
2254971..2256527
Genome map
AA seq 518 aa AA seqDB search
MLDASTKAQLKSYLERATQPIEIVASLDDSKASGEMLSLLKDVAESSPLVKLTESRDDNH
RKPSFSVNRPSENHGPRFAGLPMGHEFTSLILALLQIGGYPPKVEQAVLDQIKALDGDFE
FEIYVSLTCHNCPDVVQALNLMAIQNPRIRTTMIEGGTFQDEVKERQIMAVPTVFLNGTE
FGQGRMSLEEILAKIDTSGVEREAAKIAAKDPFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTLGIENFISIKETEGPKFAHALEEHVRDYDVDIMNLQRAKALVPGNDLI
EVQLESGASLKAKSLIISTGARWRNINVPGEHEFKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVGHVTLIEFDTALRADAVLQRKLKSLKNVDVFTNAQTTEITGDQKV
NGLVYKDRATGELKKVELEGVFIQIGLVPNTDWLKGVVELTKHGEIVVDARGQTSVPGVF
AAGDVTTVPFKQIIIAAGDGAKAALGAFDHLIRTSAPA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccagcaccaaagcccaattgaagagttacctcgaacgcgccacgcagccg
atcgagatcgtcgcttcgctcgacgacagcaaggcctcgggcgagatgctgtcgctgctg
aaggacgtcgccgagtcctcgccgctggtcaagctgactgaaagccgcgacgacaaccac
cgcaagccctcgttctcggtcaatcgcccaagcgagaaccacggcccgcgtttcgccggc
ctgccgatgggccatgaattcacgtcgctgatccttgcgctgctgcagatcggcggctac
ccgcccaaggtcgagcaagcggtgctcgaccagatcaaggcgctcgacggcgatttcgag
ttcgagatctacgtctcgctcacttgccacaactgccccgatgtcgttcaggcgctgaac
ctgatggcgatccagaacccgcgcatccgcaccacgatgatcgaaggcggcaccttccag
gatgaagtgaaggaacgccagatcatggccgtgccgaccgtcttcctgaacggcaccgaa
ttcggccaagggcgcatgagcctggaagaaatcctcgccaagatcgacaccagcggcgtc
gagcgcgaagccgcgaagatcgccgccaaggacccgttcgacgtgctcatcgtcggcggc
ggccccgcaggcgcggcagccgctgtgtatgcagcgcgcaagggcatccgcaccggcgtg
gcatcggagcgcttcggcggccaggtgctcgacacgctgggcatcgagaacttcatctcg
atcaaggaaaccgaaggaccgaagtttgcccatgcactcgaagagcatgtgcgcgactac
gacgtcgacatcatgaatctgcagcgtgccaaggccctggtgcccggcaacgacctgatc
gaagtgcaactggaaagtggcgcctcgctcaaagccaagtcgctcatcatctcgaccggt
gcgcgctggcgcaacatcaacgtgcccggcgagcacgagttcaagaacaagggggtggcc
tactgcccgcactgcgacggcccgctcttcaagggcaagcgcgtcgcggtcatcggcggc
ggcaactcgggcgtcgaagcggcgatcgacctggccggcatcgtgggccacgtcacgctg
atcgagttcgacaccgcattgcgtgccgacgcggtgctgcagcgcaaactcaagagcctg
aagaacgtcgacgtgttcaccaacgcgcagaccaccgagatcaccggcgaccagaaggtc
aacggcctcgtctacaaggaccgcgcgacgggcgagctgaagaaggtcgaactcgaaggt
gtgttcatccagatcggcctcgtgcccaataccgactggctcaagggcgtggtcgagctc
acgaagcacggcgagatcgttgtcgatgcgcgcggccagacctcggtgccgggcgtgttt
gccgcaggcgacgtgacgaccgtgccgttcaagcagatcatcatcgcggccggcgacggc
gcgaaggcggcgctcggcgcgttcgaccacctgatccgcacttcggcccctgcgtga

DBGET integrated database retrieval system