KEGG   Variovorax paradoxus EPS: Varpa_2997Help
Entry
Varpa_2997        CDS       T01392                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
vpe  Variovorax paradoxus EPS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ADU37184
UniProt: E6V6Y0
LinkDB All DBs
Position
3227858..3228958
Genome map
AA seq 366 aa AA seqDB search
MATQIAPVEPMLAKIAEEVPPEGEFLYEPKWDGFRAIVFRDAAGVRIQSRDLKPLDRYFP
ELHAALYDGLPARCVLDGEIVIAGAAGLDFDALLQRVHPAASRVERLASETPASFVAFDL
LALEGRDLQHRSQSERRMLLEAFMADVGPPIHLTPMTESRAVALQWLDHFEGAGLDGVVA
KRADGAYLPGERAMFKVKHVRTADCVLAGLRWHKSGDDAVGSLLLGLWDAQGVLQHVGAT
SSFDMATRRSLARELAPLMRNAGRGHPWIGSDDAATAALQARQRAPGARTRWNSGKDLSW
VPLRPERVCEVRYDHLQGDRFRHGAIFVRWRPDKPPAACTYAQCEVTPPYELARVFAAER
TRSASA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtggccacgcagatcgctccggtcgagccgatgctcgcgaagatcgccgaggaggtgccg
cccgaaggcgaatttctctacgagcccaaatgggacggctttcgcgccatcgtgttccgc
gacgcggcgggcgtgcgcatccagagccgcgacctcaagccgctggaccgctatttcccc
gaactgcatgcggccttgtatgacggcttgccggcgcgctgcgtgctggacggcgagatc
gtcattgccggcgcggccgggctcgacttcgatgccttgctgcagcgcgtgcatccggcg
gcttcccgcgtcgagcgcctcgcgagcgaaacgccggcgtcgttcgtggccttcgacctg
ctggcgctcgaaggccgggacctccagcaccgcagccagagcgagcggcggatgcttctg
gaagcgttcatggccgacgtcggcccgccgatccacctcacgccgatgaccgaaagccgc
gcggtcgccctgcaatggctcgaccacttcgagggcgcgggcctcgatggcgtggttgcc
aagcgcgccgacggcgcctacctgccgggcgagcgcgccatgttcaaggtgaagcacgtg
cgtacggccgactgcgtgctggccggcttgcggtggcacaagtccggcgacgacgcggtc
ggctcgctgctgctcgggctgtgggacgcgcagggcgtgctgcagcatgtgggggccacg
tcgtcgttcgacatggccacgcgccgctcactggcgcgggagctcgcgccgctcatgcgc
aacgctggccgcggccatccctggataggctccgacgacgcggccaccgcggcacttcag
gcccgccagcgtgcacccggcgcgcggacgcgatggaattccggcaaggatctctcgtgg
gtgccgctgcgtcccgagcgtgtgtgcgaggtgcgctacgaccatctgcagggcgaccgc
tttcgccacggcgccatcttcgtgcggtggcggcccgacaagccgccggccgcctgcacc
tacgcgcaatgcgaggtcacgccgccctacgaactggcgcgggtgttcgcggccgagcgc
acgcgctcggcttcggcttga

DBGET integrated database retrieval system