KEGG   Variovorax paradoxus EPS: Varpa_5168Help
Entry
Varpa_5168        CDS       T01392                                 

Definition
(GenBank) hypothetical protein
Organism
vpe  Variovorax paradoxus EPS
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADU39324
UniProt: E6V570
LinkDB All DBs
Position
complement(5621129..5625238)
Genome map
AA seq 1369 aa AA seqDB search
MRDGVRIPVDGNQTLIAGDRVIVPQDGSANVLFPGSASNKAPLAGVFTGGTDATIGSTKL
PGGLEQVNVDVASGDLQVTPPDSDADAAALAVTKKLAAGSGIGLGEFALGALGAAALGAA
LSGGGDGGSSGVPFLVPGIGDGGDADADADADADADADGDADADADADADADADADADAD
ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD
ADADADADADADADADADADADADADADADADADADADADADADADADADADADADADAD
ADADADHLLDPADNLVGGAIDAIDDTLNLGGVLAPVSGVVDGVTDVVDSVLAPLLGSEFM
PNDPNEFDPVDTAVGNILDPLGETISPVVDNILGAGVTDALLGSLLGQVDYVTDGLSNLL
GGEGPLGGLTAGLGLGELLGEDGLVGGLLDGVLGEDGLVGGLLGDDGLIGGLLGDDSLVG
GLLGDDGALGGLLGNLLGDDGALGGLLGEDGLLGGVVGGVLGADGLLGSLLGDDSALGGL
LGDDGLVGGLLGEDGVLSNLLGEDGLVGGLLGSDGLLGGLLGEDGLLGGVLGEGGPLGGV
LGGDGGLLGGLLGDDGLLGGLLGDDGLVGGLLGEDGLLGSDGVLGGLLGNDGLVGGLLGD
DGLLGGVLGDDGIVGGLLGNDGLLGGVLGDDGLVGGLLGGDGLVGGLLGDDGLLGSVLGD
DGIVGGLLGDDGLVGGLLGPDGLAGGLLGDDGIVGGLLGDDGLLGGLLGGVLGGIGNPGT
PGGPALLDPTDGIVGGIVGGLNNGVLGDLGLGDLLTPVVGLTDNVTDVVDGLLAPIFGDV
FTPNNPNVLDPVDGVVDQVTDGVSGLVSPLADQLLGAGTTAALLNAVDTQVDFLTDGVAH
LLDGDLLGGVLGDDGLLGGLLGGDGGLLGGVLGDDGLLGGLLGGDGGLLGGVLGDDGLLG
GLLGGDGGLLGGVLGDDGLLGGLLGGDGGLLGGVLGDDGLLGGLLGGDGGLLGGILGDDG
LVGGLLGGDGGLLGGVLGDDGLLGGVLGGDGGLLGGILGDDGLVGGLLGGDGGLLGGVLG
DDGLLGGVLGGDGGLLGGLLGDDGLLGGVLGGDGGLLGGILGDDGLVGGLLGGDGGLLGG
ILGDDGLVGGLLGGDGGLLGGVLGDDGLLGGVLGGDGGLLGGVLGDDGLLGGVLGGDGGL
LGGVLGDDGLLGGVLGGDGGLLGGVLGNDGLVGGLLGDDGLVGNLLGNDGLVGSLLGQDG
LVGGLLGGVLGSDGPLANILEPISGVASGLTDTVAPIVSTVTGTVSGAVAPVTDILAGAT
GTVTPVVETVVNTVDHAVTPLVTEVVTPITSLVEHTLSPVTNVLHGLLG
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacggtgtccgcatcccggtggacggcaaccagaccctgatcgcgggtgaccgc
gtgatcgttccgcaggacggctccgccaatgtgctgttccccggctcggcttccaacaag
gcgccgctggccggcgtcttcaccggcggcaccgatgcgaccatcggctcgaccaagctg
cccggcggcctcgaacaagtgaatgtggatgtggcctccggtgacctgcaggtcaccccg
cccgacagcgacgcagacgcagccgcgctggccgtgaccaagaagctcgctgccggcagc
ggcattggcctcggcgaattcgcgctgggcgcgctgggtgccgcggcactgggtgccgca
ctgagcggtggtggcgatggcggcagcagcggcgtgccgttcctggttcctggcatcggc
gatggcggcgatgcggatgcggatgccgacgcggatgcggatgccgatgccgacggtgat
gccgatgcggacgctgacgcggatgccgatgccgatgccgatgcggatgccgacgcagat
gcagatgccgatgccgacgcagatgccgatgccgatgccgacgcagatgcagatgccgat
gccgatgccgacgcagatgcagatgccgatgcggatgccgatgccgatgccgatgccgat
gcggatgccgacgctgatgccgatgcagacgctgatgccgatgcggatgcggatgccgac
gctgatgcagacgctgatgccgatgccgacgccgatgcagatgctgatgcagatgctgat
gcagatgccgatgccgatgccgatgctgatgcagatgcagatgccgatgctgatgccgat
gctgatgcagacgcagatgccgatgccgatgcagacgcagacgcagatgccgatgccgac
gccgatgccgacgcagaccacctgctcgatccagccgacaacctcgtcggcggtgccatc
gacgcgatcgacgacaccctcaacctgggcggtgtcctggcacccgtgtccggtgtggtg
gacggtgtgaccgatgtggtcgacagcgtgctcgctccgctactcggttccgaattcatg
ccgaacgatcccaacgagttcgatccggtggacaccgccgtgggcaacatcctcgatccg
ctgggcgagacgatcagccccgtcgtggacaacatcctgggcgccggcgtgaccgatgcg
ctgctcggctcgctgctgggccaggtcgactacgtgaccgacggcctgagcaacctgctc
ggcggtgaaggcccgctgggcggcctgaccgccggcctcggcctgggcgagctgctgggc
gaagacggcctcgtcggcggcctgctcgacggcgtgctgggcgaagacggcctcgttggc
ggcctcctgggcgacgacggcctgatcggcggcctcctgggcgacgacagcctcgtcggc
ggcctgctcggcgacgacggcgcgctgggcggcctcctgggcaacctgctgggcgacgac
ggcgcactgggcggcctgctcggcgaagacggcctgctcggcggcgtcgtgggcggtgtg
ctcggtgcggacggcctcctgggcagcctgctcggtgacgacagcgccctcggcggcctc
ctgggcgacgacggcctggtcggcggtctgctcggcgaagacggcgtgctcagcaacctg
ctgggtgaagacggtctggtcggcggcctgctcggctccgatggcctcctgggcggcctg
ctcggtgaagacggtctcctgggcggcgtgctgggcgaaggcggcccgctgggcggcgtg
ctcggcggcgacggcggcctgctcggcggtctcctcggtgatgacggtctcttgggcggc
ctgctcggcgacgatggattggtaggcggcctgctcggtgaagacggcctcctcggcagc
gatggcgtgctcggcggtctgcttggcaacgacggcctcgtgggtggcctgctcggcgac
gacggcctcctcggcggcgtgctgggtgacgacggcatcgtcggcggcctgctcggcaac
gacggcctcttgggcggcgtgctcggcgacgacggcctggtcggcggtctgctcggcggt
gacggcctcgtgggcggcctgctcggcgacgacggcctcctcggtagtgtgctgggcgac
gacggcatcgtcggcggcctgctcggcgacgacggtctggtcggtggcctgctcggaccg
gacggcctggccggcggcctgctgggcgacgacggcatcgtcggtggcctgctcggcgac
gacggcctcctgggcggtctgctcggcggcgtgctgggcggcatcggcaaccccggcacc
cctggcggtccggcgctgctcgatccgaccgacggcatcgtgggcggcatcgtcggcggc
ctgaacaacggcgtgctcggcgacctgggcctcggcgacctgctgaccccggtggtcggc
ctcaccgacaacgtcaccgacgtggtcgacggcctgctggcgccgatcttcggcgacgtg
ttcaccccgaacaaccccaacgtcctcgacccggtcgacggcgtggtggaccaggtgacg
gacggtgtgagcggcctcgtgagcccgctggccgaccagctgctcggcgcgggaacgacc
gcggcgctgctgaatgcggtggacacgcaagtggacttcctcaccgacggcgtggcgcat
ctgctggacggcgacctgctcggcggcgtgctgggtgacgacggcctgctgggtggtctg
ctcggcggcgacggtggcctcctcggtggcgttctgggtgacgacggcctgctgggtggt
ttgctcggcggcgacggtggcctcctcggcggtgtcctgggtgacgacggcctgctgggc
ggtctgctcggcggcgacggcggcctcctcggcggtgtcctgggtgacgacggcctgctg
ggcggtctgctcggcggcgacggtggtctcctcggcggtgtcctgggtgacgacggcctg
ctgggcggtctgctcggcggcgacggcggtctcctcggcggcatcctcggcgacgacggc
ctcgtaggcggtctgctcggtggcgacggtggcttgctcggcggcgtgctgggtgacgac
ggcttgctgggcggcgtcctcggcggcgacggtggtctcctcggcggcatcctcggcgac
gacggcctcgtgggcggtctgctcggcggtgacggcggtttgctcggcggcgtgctgggc
gacgacggcctcctgggcggcgtcctcggcggcgacggtggtttgctcggcggcttgctg
ggtgacgacggcctcctgggcggcgtcctcggcggtgacggtggcctcctcggcggcatc
ctcggcgacgacggcctcgtaggtggtctgctcggcggtgacggcggcctgctcggcggc
atcctcggcgacgacggcctcgtaggcggtctgctcggcggtgacggcggcctgctcggc
ggcgtgctgggtgacgacggcctcctgggcggcgtcctcggcggtgacggcggtttgctc
ggcggcgtgctgggtgacgacggcctcctgggcggagtcctcggcggcgacggtggcctg
ctcggcggcgtgctgggtgacgacggcctgctgggcggcgtcctcggcggtgacggcggc
ctcctcggtggcgtcctcggcaacgacggcctggtcggtggcctcctgggcgacgacggc
ctcgtgggcaacctgctgggcaacgacggtctcgtcggcagcctgctgggtcaggacggt
ctggtcggtggcttgctcggcggcgtgctgggcagcgacggcccgctcgccaacatcctg
gagccgatctccggcgtggcaagcggcctgacggacaccgtcgcgccgatcgtctcgacg
gtgacgggtacggtttccggcgcagtggcaccggtgaccgacatcctggccggcgcaacg
ggcacggtgactccggtggtcgagacggtggtgaacaccgtcgaccacgcagtcaccccg
ctggtgaccgaggtcgtgaccccgatcaccagcctggtcgaacacacgctgtcgccagtg
accaacgtcctgcacggcctgttgggttaa

DBGET integrated database retrieval system